SitesBLAST
Comparing H281DRAFT_04465 FitnessBrowser__Burk376:H281DRAFT_04465 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
39% identity, 98% coverage: 8:348/348 of query aligns to 1:338/340 of 4n54A
- active site: K96 (= K103), H183 (= H188)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (= R19), K96 (= K103), D156 (= D163), D179 (= D184), M180 (≠ C185), H183 (= H188), R238 (= R244), Y244 (≠ N250)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (= V15), G9 (= G16), L10 (= L17), G11 (= G18), R12 (= R19), L13 (= L20), S35 (= S42), V36 (≠ P43), E40 (= E47), S73 (≠ T80), P74 (= P81), F77 (≠ L84), H78 (= H85), E95 (= E102), K96 (= K103), M125 (= M132), F167 (= F174), F284 (= F290)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
35% identity, 98% coverage: 7:348/348 of query aligns to 1:340/342 of 3ceaA
- active site: K98 (= K103), H185 (= H188)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), G13 (= G18), R14 (= R19), L15 (= L20), L38 (≠ P43), Q42 (≠ E47), V74 (= V79), A75 (≠ T80), P76 (= P81), T77 (≠ S82), F79 (≠ L84), H80 (= H85), M83 (≠ Q88), E97 (= E102), K98 (= K103), M127 (= M132), F169 (= F174), H185 (= H188), F286 (= F290)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
28% identity, 96% coverage: 10:344/348 of query aligns to 3:322/336 of 3ec7A
- active site: K97 (= K103), H176 (= H188)
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), M12 (≠ R19), I13 (≠ L20), D35 (≠ S42), I36 (≠ P43), R40 (≠ E47), T73 (≠ V79), A74 (≠ T80), S75 (≠ P81), N76 (≠ S82), H79 (= H85), E96 (= E102), K97 (= K103), M126 (= M132), W271 (≠ F290), Y279 (≠ F298)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
25% identity, 96% coverage: 10:344/348 of query aligns to 3:323/337 of 4l8vA
- active site: K97 (= K103), H176 (= H188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R19), I13 (≠ L20), S74 (≠ T80), W75 (≠ P81), H79 (= H85), E96 (= E102), K97 (= K103), M126 (= M132), W272 (≠ F290), Y280 (≠ F298)
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
28% identity, 86% coverage: 10:309/348 of query aligns to 3:293/339 of 4mjlD
- active site: K97 (= K103)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K103), H155 (≠ T161), N157 (≠ D163), D172 (= D184), T173 (≠ C185), H176 (= H188), Y236 (≠ N250)
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), A12 (≠ R19), M13 (≠ L20), D35 (≠ P43), I36 (≠ L44), V73 (= V79), S74 (≠ T80), H79 (= H85), E96 (= E102), K97 (= K103), M126 (= M132), D172 (= D184), W274 (≠ F290), Y282 (≠ F298)
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
28% identity, 86% coverage: 10:309/348 of query aligns to 3:293/339 of 4mioD
- active site: K97 (= K103)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K103), H155 (≠ T161), N157 (≠ D163), D172 (= D184), T173 (≠ C185), H176 (= H188), Y236 (≠ N250)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ R19), M13 (≠ L20), D35 (≠ P43), I36 (≠ L44), S74 (≠ T80), A78 (≠ L84), H79 (= H85), E96 (= E102), K97 (= K103), M126 (= M132), D172 (= D184), W274 (≠ F290), Y282 (≠ F298)
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
28% identity, 86% coverage: 10:309/348 of query aligns to 3:293/339 of 4mioA
- active site: K97 (= K103)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G18), A12 (≠ R19), M13 (≠ L20), D35 (≠ P43), I36 (≠ L44), S74 (≠ T80), F75 (≠ P81), H79 (= H85), E96 (= E102), K97 (= K103), W274 (≠ F290), Y282 (≠ F298)
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
28% identity, 86% coverage: 10:309/348 of query aligns to 3:293/339 of 4minA
- active site: K97 (= K103)
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), A12 (≠ R19), M13 (≠ L20), D35 (≠ P43), I36 (≠ L44), V73 (= V79), S74 (≠ T80), F75 (≠ P81), H79 (= H85), E96 (= E102), K97 (= K103), Y282 (≠ F298)
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
24% identity, 96% coverage: 10:344/348 of query aligns to 3:323/337 of 3nt5A
- active site: K97 (= K103), H176 (= H188)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K103), H155 (≠ T161), H176 (= H188), Y235 (≠ N250)
- binding nicotinamide-adenine-dinucleotide: G9 (= G16), G11 (= G18), A12 (≠ R19), I13 (≠ L20), D35 (≠ S42), V36 (≠ P43), S74 (≠ T80), W75 (≠ P81), G76 (≠ S82), E96 (= E102), K97 (= K103), Y280 (≠ F298)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
24% identity, 96% coverage: 10:344/348 of query aligns to 3:323/337 of 3nt4A
- active site: K97 (= K103), H176 (= H188)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ T161), H176 (= H188), Y235 (≠ N250), W272 (≠ F290)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G18), A12 (≠ R19), I13 (≠ L20), D35 (≠ S42), V36 (≠ P43), S74 (≠ T80), W75 (≠ P81), G76 (≠ S82), E96 (= E102), K97 (= K103), H176 (= H188)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
24% identity, 96% coverage: 10:344/348 of query aligns to 3:323/337 of 3nt2B
- active site: K97 (= K103), H176 (= H188)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G16), G11 (= G18), A12 (≠ R19), D35 (≠ S42), V36 (≠ P43), S74 (≠ T80), W75 (≠ P81), A78 (≠ L84), K97 (= K103), W272 (≠ F290), Y280 (≠ F298)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
24% identity, 96% coverage: 10:344/348 of query aligns to 3:323/337 of 3nt2A
- active site: K97 (= K103), H176 (= H188)
- binding nicotinamide-adenine-dinucleotide: G9 (= G16), G11 (= G18), A12 (≠ R19), I13 (≠ L20), D35 (≠ S42), V36 (≠ P43), S74 (≠ T80), W75 (≠ P81), G76 (≠ S82), A78 (≠ L84), H79 (= H85), E96 (= E102), K97 (= K103), H176 (= H188), Y280 (≠ F298)
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
32% identity, 76% coverage: 10:273/348 of query aligns to 2:259/333 of 4koaA
- active site: K94 (= K103), H180 (= H188)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G16), A9 (≠ L17), S10 (≠ G18), T11 (≠ R19), I12 (≠ L20), S33 (= S42), S34 (≠ P43), R38 (vs. gap), T71 (= T80), N73 (≠ S82), H76 (= H85), K94 (= K103), Q160 (≠ D168)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
28% identity, 97% coverage: 11:348/348 of query aligns to 2:328/332 of 2glxA
- active site: K93 (= K103), H179 (= H188)
- binding acetate ion: K93 (= K103), H179 (= H188)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G16), A8 (≠ L17), S9 (≠ G18), T10 (≠ R19), I11 (≠ L20), S32 (= S42), T33 (≠ P43), R37 (≠ E47), S69 (≠ V79), T70 (= T80), N72 (≠ S82), H75 (= H85), E92 (= E102), K93 (= K103), H121 (≠ F131), W161 (≠ F170), R162 (≠ F171), Y282 (≠ F294)
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
28% identity, 85% coverage: 10:306/348 of query aligns to 2:285/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ R19), F152 (≠ T161), N154 (≠ D163), D175 (= D184), L176 (≠ C185), H179 (= H188), E236 (≠ N250), W271 (≠ F294)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G18), F11 (≠ R19), M12 (≠ L20), D33 (≠ E45), L34 (≠ E46), T70 (≠ V79), T71 (= T80), P72 (= P81), N73 (≠ S82), L75 (= L84), H76 (= H85), Q79 (= Q88), E93 (= E102), K94 (= K103), N122 (≠ M132), W161 (≠ F170), H179 (= H188)
Sites not aligning to the query:
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
28% identity, 85% coverage: 10:306/348 of query aligns to 2:285/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ R19), N154 (≠ D163), D175 (= D184), H179 (= H188), E236 (≠ N250), W271 (≠ F294)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G16), G10 (= G18), F11 (≠ R19), M12 (≠ L20), D33 (≠ E45), L34 (≠ E46), T70 (≠ V79), T71 (= T80), P72 (= P81), N73 (≠ S82), L75 (= L84), H76 (= H85), Q79 (= Q88), E93 (= E102), K94 (= K103), N122 (≠ M132), W161 (≠ F170)
Sites not aligning to the query:
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
28% identity, 85% coverage: 10:306/348 of query aligns to 2:285/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G18), F11 (≠ R19), M12 (≠ L20), D33 (≠ E45), L34 (≠ E46), T70 (≠ V79), T71 (= T80), P72 (= P81), N73 (≠ S82), L75 (= L84), H76 (= H85), Q79 (= Q88), E93 (= E102), K94 (= K103), N122 (≠ M132), W161 (≠ F170), H179 (= H188)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
28% identity, 97% coverage: 11:348/348 of query aligns to 3:329/333 of Q2I8V6
- ASTI 9:12 (≠ LGRL 17:20) binding
- S10 (≠ G18) mutation to G: Almost no effect.
- A13 (≠ G21) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (= S42) mutation to D: No activity.
- ST 33:34 (≠ SP 42:43) binding
- R38 (≠ E47) binding
- TTNELH 71:76 (≠ TPSSLH 80:85) binding
- EK 93:94 (= EK 102:103) binding
- K94 (= K103) mutation to G: Less than 1% remaining activity.
- N120 (≠ I129) binding
- WR 162:163 (≠ FF 170:171) binding
- D176 (= D184) mutation to A: Less than 1% remaining activity.
- H180 (= H188) mutation to A: Less than 2% remaining activity.
- G206 (≠ R218) mutation to I: No effect.
- Y283 (≠ F294) binding
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
33% identity, 57% coverage: 9:207/348 of query aligns to 3:194/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (≠ F131), Q173 (≠ C185), H176 (= H188)
- binding nicotinamide-adenine-dinucleotide: G10 (= G16), G12 (= G18), R13 (= R19), A14 (≠ L20), D35 (≠ S42), P36 (= P43), R37 (≠ L44), A71 (≠ V79), S72 (≠ T80), P73 (= P81), F76 (≠ L84), Q80 (= Q88), E94 (= E102), K95 (= K103), P96 (= P104), R161 (= R173), P163 (≠ A175), E164 (≠ A176)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
31% identity, 40% coverage: 61:199/348 of query aligns to 89:230/383 of 1h6dA
- active site: K131 (= K103), Y219 (≠ H188)
- binding glycerol: K131 (= K103), R202 (≠ F171), D215 (= D184), Y219 (≠ H188)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y89 (= Y61), I107 (≠ V79), L108 (≠ T80), P109 (= P81), N110 (≠ S82), H113 (= H85), E130 (= E102), K131 (= K103), R159 (≠ M132), A198 (≠ T167), W201 (≠ F170), R202 (≠ F171), Y219 (≠ H188)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 17, 18, 19, 40, 41, 42, 43, 44, 66, 67, 71, 298
Query Sequence
>H281DRAFT_04465 FitnessBrowser__Burk376:H281DRAFT_04465
MSAAASTRRLRFGVVGLGRLGKRHAENLAYRVPGAELVAACSPLEEERAWARDALPSPRL
YDDYARLLDDKDVDAVWLVTPSSLHAQQIVDALRAGKHVFCEKPLSLDLAECERVLHEAA
QYPHLQATIGFMRRFDPSYKDAFDKIEAGAIGRPFLVRSQTTDKNDTDGFFVRFAATSGG
IFLDCTVHDIDVARWLLGKPRAKRVFAAGAVALHEGLREFGDVDNGVAICEFEDGKLAMF
YASRTQAHGNDTHSEVIGTAGGLTIGHNPRANRVEIYDATGIRNECTPGFFDRFEEAFLH
EARAFVASVQGGAGSAVQAGATLADALEATRIGNALRQSLQSGQAVTL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory