SitesBLAST
Comparing H281DRAFT_04467 FitnessBrowser__Burk376:H281DRAFT_04467 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
88% identity, 98% coverage: 2:287/293 of query aligns to 1:282/282 of 5ve7A
- binding uridine 5'-triphosphate: P9 (= P10), V10 (= V11), A11 (= A12), G12 (= G13), G14 (= G15), T15 (= T16), R16 (= R17), K26 (= K27), E27 (= E28), Q104 (= Q105), A107 (= A108), G109 (= G110), A113 (= A114)
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
86% identity, 98% coverage: 1:287/293 of query aligns to 2:288/290 of 5i1fA
- binding uridine-5'-diphosphate-glucose: P11 (= P10), A13 (= A12), G14 (= G13), K28 (= K27), E29 (= E28), Q106 (= Q105), A109 (= A108), L110 (= L109), G111 (= G110), L112 (= L111), A115 (= A114), D135 (= D134), Y172 (= Y171), G173 (= G172), E192 (= E191), K193 (= K192), V205 (= V204)
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
52% identity, 92% coverage: 6:276/293 of query aligns to 7:275/288 of 2ux8G
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
51% identity, 90% coverage: 4:266/293 of query aligns to 8:271/281 of 8f73E
- binding uridine-5'-diphosphate-glucose: P14 (= P10), A16 (= A12), G17 (= G13), K31 (= K27), E32 (= E28), Q108 (= Q105), G113 (= G110), L114 (= L111), A117 (= A114), L134 (= L131), D137 (= D134), E196 (= E191), K197 (= K192), I209 (≠ V204)
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
48% identity, 96% coverage: 4:284/293 of query aligns to 2:286/290 of 6knlA
- binding triphosphate: G13 (= G15), T14 (= T16), R15 (= R17), K79 (≠ R81), K81 (= K83)
- binding uridine: P8 (= P10), G11 (= G13), K25 (= K27), Q103 (= Q105), P106 (≠ A108), G108 (= G110), P130 (≠ A132), D131 (= D133)
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
48% identity, 96% coverage: 4:284/293 of query aligns to 2:286/290 of 6k8dA
- binding uridine-5'-diphosphate-glucose: P8 (= P10), A10 (= A12), G11 (= G13), Q103 (= Q105), P106 (≠ A108), G108 (= G110), L109 (= L111), A112 (= A114), L129 (= L131), D131 (= D133), E193 (= E191), V206 (= V204)
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
48% identity, 90% coverage: 4:266/293 of query aligns to 2:257/265 of 3jukA
- binding uridine-5'-diphosphate-glucose: A10 (= A12), G11 (= G13), E26 (= E28), Q94 (= Q105), M97 (≠ A108), G99 (= G110), L100 (= L111), A103 (= A114), D123 (= D134), Y162 (= Y171), G163 (= G172), E182 (= E191), K183 (= K192), V195 (= V204)
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
48% identity, 90% coverage: 4:266/293 of query aligns to 2:257/264 of 3jukD
- binding magnesium ion: T14 (= T16), R15 (= R17)
- binding uridine-5'-diphosphate-glucose: P8 (= P10), A10 (= A12), G11 (= G13), E26 (= E28), Q94 (= Q105), M97 (≠ A108), G99 (= G110), L100 (= L111), A103 (= A114), L120 (= L131), D123 (= D134), Y162 (= Y171), G163 (= G172), E182 (= E191), K183 (= K192), V195 (= V204)
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
47% identity, 96% coverage: 4:284/293 of query aligns to 2:281/285 of 6ikzB
- binding uridine 5'-triphosphate: P8 (= P10), V9 (= V11), A10 (= A12), G11 (= G13), L12 (= L14), G13 (= G15), T14 (= T16), R15 (= R17), K25 (= K27), Q103 (= Q105), P106 (≠ A108), G108 (= G110), D131 (= D133)
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
46% identity, 92% coverage: 6:276/293 of query aligns to 7:242/255 of 2ux8A
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
41% identity, 97% coverage: 5:287/293 of query aligns to 3:287/291 of 8b6dA
- binding uridine-5'-diphosphate: P8 (= P10), A10 (= A12), G11 (= G13), L12 (= L14), G13 (= G15), T14 (= T16), R15 (= R17), K25 (= K27), Q102 (= Q105), A105 (= A108), G107 (= G110), A111 (= A114)
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
42% identity, 96% coverage: 4:285/293 of query aligns to 3:287/299 of 2pa4B
- binding uridine-5'-diphosphate-glucose: P9 (= P10), A10 (≠ V11), A11 (= A12), G12 (= G13), E27 (= E28), Q103 (= Q105), P106 (≠ A108), G108 (= G110), L109 (= L111), L131 (= L131), P132 (≠ A132), D134 (= D134), Y170 (= Y171), G171 (= G172), E192 (= E191), K193 (= K192), A205 (≠ V204)
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
39% identity, 97% coverage: 5:287/293 of query aligns to 3:282/286 of 8b68A
- binding uridine-5'-diphosphate-glucose: P8 (= P10), A10 (= A12), G11 (= G13), Q102 (= Q105), A105 (= A108), G107 (= G110), A111 (= A114), L130 (= L131), P131 (≠ A132), D133 (= D134), A203 (≠ V204), G205 (= G206)
5z09A St0452(y97n)-utp binding form (see paper)
30% identity, 86% coverage: 6:257/293 of query aligns to 2:210/401 of 5z09A
- binding uridine 5'-triphosphate: L6 (≠ P10), A7 (≠ V11), A8 (= A12), G9 (= G13), S10 (≠ L14), G11 (= G15), E12 (≠ T16), R13 (= R17), Q73 (≠ R104), G79 (= G110), G98 (≠ D133), D99 (= D134)
2ggqA Complex of hypothetical glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii
30% identity, 86% coverage: 6:257/293 of query aligns to 2:210/401 of 2ggqA
- active site: R13 (= R17)
- binding thymidine-5'-triphosphate: L6 (≠ P10), A8 (= A12), G9 (= G13), S10 (≠ L14), G11 (= G15), E12 (≠ T16), R13 (= R17), K23 (= K27), Q73 (≠ R104), G79 (= G110), A83 (= A114), R179 (≠ G226), E181 (= E228)
Sites not aligning to the query:
Q975F9 Bifunctional sugar-1-phosphate nucleotidylyltransferase/acetyltransferase; EC 2.7.7.24; EC 2.7.7.9; EC 2.7.7.83; EC 2.7.7.23; EC 2.3.1.276; EC 2.3.1.157 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 3 papers)
30% identity, 86% coverage: 6:257/293 of query aligns to 2:210/401 of Q975F9
- AGSGER 8:13 (≠ AGLGTR 12:17) binding
- Q73 (≠ R104) binding
- G79 (= G110) binding
- T80 (≠ L111) mutation T->A,G,Q: Increases both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation T->D,H: Decrease in GlcNAc-1-P UTase activity but increase in Glc-1-P UTase activity.; mutation T->E,K,L,M,R,W,Y: Strong decrease in GlcNAc-1-P UTase activity and loss of Glc-1-P UTase activity.; mutation T->F,I: Loss of both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation T->N,S: Strong increase in GlcNAc-1-P UTase activity and decrease in Glc-1-P UTase activity.; mutation to N: Loss of GlcNAc-1-P UTase activity; when associated with V-97.
- Y97 (≠ A132) mutation Y->A,D,F,G,I,K,T,V: Increases GlcNAc-1-P UTase activity. Decreases Glc-1-P UTase activity.; mutation Y->C,E,P,R,W: Decreases GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation Y->H,L,M,N,Q,S: Increases GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation to V: Loss of GlcNAc-1-P UTase activity; when associated with N-80.
- E146 (= E191) mutation E->A,C,F,G,I,K,L,M,P,Q,R,V,W,Y: Loss of both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation E->D,N: Decrease in GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation E->H,S,T: Decrease in GlcNAc-1-P UTase activity and loss of Glc-1-P UTase activity.
Sites not aligning to the query:
- 308 H→A: Strong decrease in GalN-1-P AcTase activity and almost loss of GlcN-1-P AcTase activity.
- 311 Y→A: Strong decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 331 N→A: Strong decrease in GalN-1-P AcTase activity and decrease in GlcN-1-P AcTase activity.
- 337 K→A: Slight decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 340 K→A: Decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 391:401 mutation Missing: No change in GlcNAc-1-P UTase activity. Shows 38% less GalN-1-P AcTase activity than the wild-type, but increases GlcN-1-P AcTase activity 16.8 times. Significantly affects the thermostability of the entire protein.
- 397:401 mutation Missing: No change in GlcNAc-1-P UTase activity. Shows 20% less GalN-1-P AcTase activity than the wild-type, but increases GlcN-1-P AcTase activity 4.8 times. Does not affect thermostability.
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
27% identity, 82% coverage: 6:244/293 of query aligns to 13:221/302 of 4b2xB
Sites not aligning to the query:
3zllA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
27% identity, 82% coverage: 6:244/293 of query aligns to 8:216/297 of 3zllA
Sites not aligning to the query:
3zlkA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
27% identity, 82% coverage: 6:244/293 of query aligns to 8:216/297 of 3zlkA
Sites not aligning to the query:
5fu8A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
27% identity, 82% coverage: 6:244/293 of query aligns to 8:216/297 of 5fu8A
Sites not aligning to the query:
Query Sequence
>H281DRAFT_04467 FitnessBrowser__Burk376:H281DRAFT_04467
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKDKLLELVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVGDNPFAVILADDLLYGTPPVMTQMIEVFDHYHSSVIGVEEIPAQETKSYGIVDGKEWE
DSIIKMSGIVEKPEPSVAPSNLGVVGRYVLKPRIFDHIRSIKPGAGGELQLTDAIQSLLA
DEQVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVAADFDEYLRTRSPVLEG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory