SitesBLAST
Comparing H281DRAFT_04480 FitnessBrowser__Burk376:H281DRAFT_04480 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
51% identity, 97% coverage: 14:471/474 of query aligns to 14:465/465 of 3pm9A
- active site: A149 (= A151), L159 (≠ N161)
- binding flavin-adenine dinucleotide: P69 (= P69), Q70 (= Q70), G71 (= G71), G72 (= G72), N73 (= N73), T74 (= T74), G75 (= G75), L76 (= L76), G79 (= G79), Q80 (≠ A80), L91 (= L93), L133 (= L135), G134 (≠ A136), A135 (= A137), C139 (= C141), T140 (= T142), G142 (= G144), G143 (= G145), S146 (≠ A148), T147 (= T149), A149 (= A151), G150 (= G152), E200 (= E202), G201 (= G203), I205 (= I207), I206 (= I208), E423 (= E429)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
39% identity, 96% coverage: 19:473/474 of query aligns to 25:466/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R332), T337 (≠ P336), K348 (= K347), Y379 (≠ F380), H381 (= H382), H388 (= H389), H423 (= H430)
- binding flavin-adenine dinucleotide: W39 (= W33), P75 (= P69), Q76 (= Q70), G77 (= G71), G78 (= G72), N79 (= N73), T80 (= T74), G81 (= G75), M82 (≠ L76), G85 (= G79), S86 (≠ A80), L139 (= L135), G140 (≠ A136), A141 (= A137), C145 (= C141), G149 (= G145), N150 (= N146), A152 (= A148), T153 (= T149), G157 (= G153), G207 (= G203), I212 (= I208), E422 (= E429), N459 (= N466)
- binding zinc ion: H381 (= H382), H388 (= H389), E422 (= E429)
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
39% identity, 96% coverage: 19:473/474 of query aligns to 25:466/466 of 6lpuA
- binding flavin-adenine dinucleotide: W39 (= W33), P75 (= P69), G77 (= G71), G78 (= G72), N79 (= N73), T80 (= T74), G81 (= G75), G85 (= G79), S86 (≠ A80), L139 (= L135), G140 (≠ A136), A141 (= A137), C145 (= C141), H146 (≠ T142), G148 (= G144), G149 (= G145), N150 (= N146), A152 (= A148), T153 (= T149), A155 (= A151), E206 (= E202), G207 (= G203), I211 (= I207), I212 (= I208), E422 (= E429), N459 (= N466)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R332), T337 (≠ P336), K348 (= K347), Y379 (≠ F380), H381 (= H382), H388 (= H389), H423 (= H430)
- binding zinc ion: H381 (= H382), H388 (= H389), E422 (= E429)
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
39% identity, 96% coverage: 19:473/474 of query aligns to 25:466/466 of 6lpqA
- binding flavin-adenine dinucleotide: W39 (= W33), P75 (= P69), G77 (= G71), G78 (= G72), N79 (= N73), T80 (= T74), G81 (= G75), G85 (= G79), S86 (≠ A80), L139 (= L135), G140 (≠ A136), A141 (= A137), C145 (= C141), H146 (≠ T142), G149 (= G145), N150 (= N146), A152 (= A148), T153 (= T149), A155 (= A151), G157 (= G153), E206 (= E202), G207 (= G203), I211 (= I207), I212 (= I208), E422 (= E429), N459 (= N466)
- binding d-malate: M82 (≠ L76), R333 (= R332), T337 (≠ P336), K348 (= K347), Y379 (≠ F380), H381 (= H382), H388 (= H389), E422 (= E429), H423 (= H430)
- binding zinc ion: H381 (= H382), H388 (= H389), E422 (= E429)
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
39% identity, 96% coverage: 19:473/474 of query aligns to 25:466/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R332), T337 (≠ P336), K348 (= K347), Y379 (≠ F380), H381 (= H382), H388 (= H389), N390 (= N391), H423 (= H430)
- binding flavin-adenine dinucleotide: W39 (= W33), P75 (= P69), G77 (= G71), G78 (= G72), N79 (= N73), T80 (= T74), G81 (= G75), M82 (≠ L76), G85 (= G79), S86 (≠ A80), L139 (= L135), G140 (≠ A136), A141 (= A137), C145 (= C141), G149 (= G145), N150 (= N146), A152 (= A148), T153 (= T149), A155 (= A151), G157 (= G153), G207 (= G203), I212 (= I208), E422 (= E429), H423 (= H430)
- binding zinc ion: H381 (= H382), H388 (= H389), E422 (= E429)
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
39% identity, 96% coverage: 19:473/474 of query aligns to 26:467/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (= W33), P76 (= P69), G78 (= G71), G79 (= G72), N80 (= N73), T81 (= T74), G82 (= G75), M83 (≠ L76), G86 (= G79), S87 (≠ A80), L140 (= L135), A142 (= A137), C146 (= C141), H147 (≠ T142), G150 (= G145), N151 (= N146), A153 (= A148), T154 (= T149), G208 (= G203), I212 (= I207), I213 (= I208), E423 (= E429), N460 (= N466)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
39% identity, 96% coverage: 19:474/474 of query aligns to 78:520/521 of Q8N465
- S109 (≠ P50) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V68) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G72) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V90) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L96) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V115) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P132) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A148) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ P174) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G176) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S321) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R332) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ P336) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ N345) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (= K347) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ D365) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (= A375) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H382) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G384) to V: slight reduction in catalytic activity
- N439 (= N387) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H389) binding ; mutation to A: Loss of catalytic activity.
- N443 (= N391) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (= V392) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (= A400) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E429) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H430) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G431) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
31% identity, 94% coverage: 27:471/474 of query aligns to 54:496/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
33% identity, 89% coverage: 49:472/474 of query aligns to 53:465/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P69), G75 (= G71), S76 (≠ G72), G77 (≠ N73), T78 (= T74), G79 (= G75), L80 (= L76), A83 (≠ G79), C84 (≠ A80), P137 (≠ A136), G138 (≠ A137), E139 (= E138), A142 (≠ C141), T143 (= T142), G146 (= G145), N147 (= N146), S149 (≠ A148), T150 (= T149), A152 (= A151), G153 (= G152), E203 (= E202), G204 (= G203), I209 (= I208), E422 (= E429), H423 (= H430)
- binding fe (iii) ion: H377 (= H382), H384 (= H389), E422 (= E429)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 90% coverage: 47:471/474 of query aligns to 46:456/459 of P9WIT1
- K354 (≠ H359) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
30% identity, 98% coverage: 6:471/474 of query aligns to 5:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L76), R317 (= R332), W321 (vs. gap), H368 (= H382), H375 (= H389), H413 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P69), G70 (= G71), T71 (≠ G72), G72 (≠ N73), T73 (= T74), G74 (= G75), G78 (= G79), V79 (≠ A80), L90 (= L93), P132 (≠ L135), G133 (≠ A136), A134 (= A137), G140 (= G145), M141 (≠ N146), A143 (= A148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (= I208), W321 (vs. gap), Y322 (≠ H334), E412 (= E429), H413 (= H430), N449 (= N466)
- binding manganese (ii) ion: H368 (= H382), H375 (= H389), E412 (= E429)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
29% identity, 98% coverage: 6:471/474 of query aligns to 5:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R332), W322 (vs. gap), H369 (= H382), H376 (= H389), H414 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P69), G70 (= G71), T71 (≠ G72), G72 (≠ N73), T73 (= T74), G74 (= G75), G78 (= G79), V79 (≠ A80), L90 (= L93), P132 (≠ L135), G133 (≠ A136), A134 (= A137), G140 (= G145), M141 (≠ N146), A143 (= A148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (= I208), W322 (vs. gap), E413 (= E429), N450 (= N466)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E429)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
30% identity, 98% coverage: 6:471/474 of query aligns to 5:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R332), H369 (= H382), H376 (= H389), H414 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P69), G70 (= G71), T71 (≠ G72), G72 (≠ N73), T73 (= T74), G74 (= G75), G78 (= G79), V79 (≠ A80), L90 (= L93), P132 (≠ L135), G133 (≠ A136), A134 (= A137), G140 (= G145), M141 (≠ N146), A143 (= A148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (= I208), W322 (vs. gap), E413 (= E429), H414 (= H430), N450 (= N466)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E429)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
30% identity, 98% coverage: 6:471/474 of query aligns to 5:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R332), W322 (vs. gap), H369 (= H382), H376 (= H389), H413 (= H430)
- binding flavin-adenine dinucleotide: E32 (≠ W33), P68 (= P69), G70 (= G71), T71 (≠ G72), G72 (≠ N73), T73 (= T74), G74 (= G75), G78 (= G79), V79 (≠ A80), L90 (= L93), P132 (≠ L135), G133 (≠ A136), A134 (= A137), G140 (= G145), M141 (≠ N146), A143 (= A148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (= I208), W322 (vs. gap), E412 (= E429), H413 (= H430), N449 (= N466)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E412 (= E429)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
30% identity, 98% coverage: 6:471/474 of query aligns to 5:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R332), W322 (vs. gap), S336 (≠ K347), H369 (= H382), H376 (= H389), H413 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P69), G70 (= G71), T71 (≠ G72), G72 (≠ N73), T73 (= T74), G74 (= G75), G78 (= G79), V79 (≠ A80), L90 (= L93), P132 (≠ L135), G133 (≠ A136), A134 (= A137), G140 (= G145), M141 (≠ N146), A143 (= A148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (= I208), E412 (= E429), N449 (= N466)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E412 (= E429)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
29% identity, 98% coverage: 6:471/474 of query aligns to 5:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P69), G70 (= G71), T71 (≠ G72), G72 (≠ N73), T73 (= T74), G74 (= G75), G78 (= G79), V79 (≠ A80), L90 (= L93), P132 (≠ L135), G133 (≠ A136), A134 (= A137), G140 (= G145), M141 (≠ N146), A143 (= A148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (= I208), W322 (vs. gap), E413 (= E429), H414 (= H430), N450 (= N466)
- binding lactic acid: R318 (= R332), H369 (= H382), H376 (= H389), H414 (= H430)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E429)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
29% identity, 98% coverage: 6:471/474 of query aligns to 5:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ W33), P68 (= P69), G70 (= G71), T71 (≠ G72), G72 (≠ N73), T73 (= T74), G74 (= G75), G78 (= G79), V79 (≠ A80), L90 (= L93), P132 (≠ L135), G133 (≠ A136), A134 (= A137), G140 (= G145), M141 (≠ N146), A143 (= A148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (= I208), W323 (vs. gap), E414 (= E429), H415 (= H430), N451 (= N466)
- binding manganese (ii) ion: H370 (= H382), H377 (= H389), E414 (= E429)
- binding pyruvic acid: R319 (= R332), H370 (= H382), H377 (= H389), H415 (= H430)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
29% identity, 98% coverage: 6:471/474 of query aligns to 5:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ W33), P68 (= P69), G70 (= G71), T71 (≠ G72), G72 (≠ N73), T73 (= T74), G74 (= G75), G78 (= G79), V79 (≠ A80), L90 (= L93), P132 (≠ L135), G133 (≠ A136), A134 (= A137), G140 (= G145), M141 (≠ N146), A143 (= A148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (= I208), W322 (vs. gap), E413 (= E429), H414 (= H430), N450 (= N466)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R332), H369 (= H382), H376 (= H389), H414 (= H430)
- binding manganese (ii) ion: H369 (= H382), H376 (= H389), E413 (= E429)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
29% identity, 98% coverage: 6:471/474 of query aligns to 5:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P69), G70 (= G71), T71 (≠ G72), G72 (≠ N73), T73 (= T74), G74 (= G75), G78 (= G79), V79 (≠ A80), L90 (= L93), P132 (≠ L135), G133 (≠ A136), A134 (= A137), G140 (= G145), M141 (≠ N146), A143 (= A148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (= I208), Y324 (≠ H334), H370 (= H382), E414 (= E429), N451 (= N466)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R332), W323 (vs. gap), H415 (= H430)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
29% identity, 98% coverage: 6:471/474 of query aligns to 5:456/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R332), W323 (vs. gap), H370 (= H382), H415 (= H430)
- binding flavin-adenine dinucleotide: P68 (= P69), G70 (= G71), T71 (≠ G72), G72 (≠ N73), T73 (= T74), G74 (= G75), G78 (= G79), V79 (≠ A80), L90 (= L93), P132 (≠ L135), G133 (≠ A136), A134 (= A137), G140 (= G145), M141 (≠ N146), A143 (= A148), T144 (= T149), A146 (= A151), S147 (≠ G152), E200 (= E202), G201 (= G203), I206 (= I208), H370 (= H382), E414 (= E429), N451 (= N466)
Query Sequence
>H281DRAFT_04480 FitnessBrowser__Burk376:H281DRAFT_04480
MTQTAFLTACRDAIGAAHVLTDAHDTAPYLTDWRRRYTGAACAVLCPATPDEVAALVKLA
VEHGIAVVPQGGNTGLAGGATPDSSGAQAVVSLRRLNRVRDIDPHNNTITVEAGVILAEV
QKRAEEAGRLFPLSLAAEGSCTIGGNLATNAGGTGVLRYGNTRELCLGLEVVTPQGELWD
GLRGLRKDNTGYDLRDLFIGAEGTLGIITAAVLKLHPQPAARVTALAALASPHAALDFLS
LTQSVAGPLLTGFELMSDFCLRLVGRHFEQMRYPFAEPHAQIVLLELSDSESEEHARALF
ERLMEQALEDGMVQDAVVAESLAQSRAFWNLREHIPLAQAEEGLNIKHDIAVPISRIGHF
IEETDAAIEQAAPGARMVTFGHLGDGNLHYNVQAPEGVDAKAFLEQYQSPINRVVYDSVH
RHRGSISAEHGLGQLKIDEAMHYKPDVEVQLMQAVKRALDPLNLMNPGKVLRSN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory