Comparing H281DRAFT_04512 FitnessBrowser__Burk376:H281DRAFT_04512 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
22% identity, 47% coverage: 38:248/449 of query aligns to 56:249/444 of Q8NLB7
Sites not aligning to the query:
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
23% identity, 67% coverage: 86:387/449 of query aligns to 78:387/452 of Q5EXK5
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
27% identity, 38% coverage: 86:256/449 of query aligns to 63:217/446 of A0A0H2VG78
Sites not aligning to the query:
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
21% identity, 55% coverage: 11:258/449 of query aligns to 37:312/587 of P25297
Sites not aligning to the query:
8fvzA Pipt y150a
23% identity, 40% coverage: 21:201/449 of query aligns to 2:184/433 of 8fvzA
Sites not aligning to the query:
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
24% identity, 85% coverage: 16:395/449 of query aligns to 22:402/448 of Q51955
Sites not aligning to the query:
8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
23% identity, 74% coverage: 74:406/449 of query aligns to 140:429/453 of 8sc2A
Sites not aligning to the query:
Q9R0W2 Solute carrier family 22 member 2; Organic cation transporter 2; rOCT2 from Rattus norvegicus (Rat) (see paper)
33% identity, 18% coverage: 73:154/449 of query aligns to 158:228/555 of Q9R0W2
Sites not aligning to the query:
>H281DRAFT_04512 FitnessBrowser__Burk376:H281DRAFT_04512
MQTVMQAVTPAAAAPPLSRSQMRRAVLASVIGNGLEWFDFLIYGYFAKVIAQVYFPANNS
FVSITLTLATFAIGFLVRPLGGIVIGACADRYGRRKTLSLLILLMALSTLMMGLTPGYAT
IGIAAPLIVIVARILQGLSVGGEFATAAAMLTEYAPPRRKMFFGSFQMTSQAVALLLSSL
CALLLTTRLSHESLVSWGWRVPFLLGALVGPVGFYIRHKVGESPEFLQLRERLGHAPRQS
LRTFIRERGDAALCAMGVIIVGAATNYLWHSYMPLYVEHQLHLPLKNALFGTAISGLIGI
AGYPLAGRLADRFGAYRLFFPVAIAWVCVAYPLFAWVLAAPSAERVFTAQMIATVVLSLM
SGAHPGMLTQLFPTSTRSTGVALSYNVAVTLFGGLAPLTVSTLIDVTGSRLVPAWYLICA
GVISLLLVGLTASGRRLVRKPDLWLADGQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory