SitesBLAST
Comparing H281DRAFT_04551 FitnessBrowser__Burk376:H281DRAFT_04551 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
42% identity, 95% coverage: 23:581/587 of query aligns to 96:658/667 of P09342
- C161 (= C88) modified: Disulfide link with 307
- P194 (= P121) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ L234) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
43% identity, 95% coverage: 23:581/587 of query aligns to 93:655/664 of P09114
- P191 (= P121) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W500) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
43% identity, 95% coverage: 23:581/587 of query aligns to 10:569/591 of 5wkcA
- active site: Y29 (= Y42), G31 (= G44), G32 (= G45), A33 (≠ S46), I34 (≠ V47), E55 (= E68), T78 (= T91), F117 (= F130), Q118 (= Q131), E119 (= E132), K167 (= K180), R222 (= R239), M258 (= M275), V285 (= V302), V401 (= V411), L426 (= L436), G427 (= G437), M429 (= M439), D454 (≠ E464), N481 (= N491), E483 (≠ Y493), Q484 (≠ L494), M486 (= M496), V487 (= V497), W490 (= W500), L512 (= L523), G517 (= G528), L518 (≠ H529), K551 (≠ P563)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (= V411), G402 (= G412), Q403 (= Q413), H404 (= H414), G427 (= G437), M429 (= M439), G453 (= G463), D454 (≠ E464), A455 (≠ G465), S456 (= S466), M459 (= M469), N481 (= N491), E483 (≠ Y493), Q484 (≠ L494), G485 (= G495), M486 (= M496), V487 (= V497)
- binding ethaneperoxoic acid: G32 (= G45), Q118 (= Q131)
- binding flavin-adenine dinucleotide: R157 (= R170), G211 (= G229), A212 (≠ G230), G213 (= G231), N216 (vs. gap), T238 (= T255), L239 (= L256), Q240 (≠ M257), L256 (= L273), M258 (= M275), G278 (= G295), A279 (= A296), R280 (= R297), R284 (= R301), V285 (= V302), E311 (≠ D320), V312 (≠ I321), N316 (≠ S325), D330 (= D339), A331 (≠ V340), M406 (= M416), G424 (= G434)
- binding magnesium ion: D454 (≠ E464), N481 (= N491), E483 (≠ Y493)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (= G45), A33 (≠ S46), V107 (= V120), F117 (= F130), K167 (= K180), M258 (= M275), R284 (= R301), M486 (= M496), W490 (= W500)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (= P43), E55 (= E68)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
43% identity, 95% coverage: 23:581/587 of query aligns to 10:574/596 of 1t9cA
- active site: Y29 (= Y42), G31 (= G44), G32 (= G45), A33 (≠ S46), I34 (≠ V47), E55 (= E68), T78 (= T91), F117 (= F130), Q118 (= Q131), E119 (= E132), K167 (= K180), R227 (= R239), M263 (= M275), V290 (= V302), V406 (= V411), L431 (= L436), G432 (= G437), M434 (= M439), D459 (≠ E464), N486 (= N491), E488 (≠ Y493), Q489 (≠ L494), M491 (= M496), V492 (= V497), W495 (= W500), L517 (= L523), G522 (= G528), L523 (≠ H529), K556 (≠ P563)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G45), V107 (= V120), P108 (= P121), F117 (= F130), K167 (= K180), D288 (= D300), R289 (= R301), W495 (= W500)
- binding flavin-adenine dinucleotide: R157 (= R170), G216 (= G229), A217 (≠ G230), G218 (= G231), N221 (vs. gap), T243 (= T255), L244 (= L256), Q245 (≠ M257), L261 (= L273), M263 (= M275), H264 (= H276), G283 (= G295), A284 (= A296), R285 (= R297), D287 (= D299), R289 (= R301), V290 (= V302), E316 (≠ D320), V317 (≠ I321), N321 (≠ S325), G334 (= G338), D335 (= D339), A336 (≠ V340), M411 (= M416), G429 (= G434), G430 (= G435)
- binding magnesium ion: D459 (≠ E464), N486 (= N491), E488 (≠ Y493)
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
43% identity, 95% coverage: 23:581/587 of query aligns to 94:665/687 of P07342
- R241 (= R170) binding
- 355:376 (vs. 276:297, 55% identical) binding
- 407:426 (vs. 320:339, 35% identical) binding
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
43% identity, 95% coverage: 23:581/587 of query aligns to 14:585/607 of 6u9dB
- active site: Y33 (= Y42), G35 (= G44), G36 (= G45), A37 (≠ S46), I38 (≠ V47), E59 (= E68), T82 (= T91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M274 (= M275), V301 (= V302), V417 (= V411), G443 (= G437), M445 (= M439), D470 (≠ E464), N497 (= N491), E499 (≠ Y493), Q500 (≠ L494), M502 (= M496), V503 (= V497), W506 (= W500)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (= G45), V111 (= V120), P112 (= P121), F121 (= F130), K171 (= K180), D299 (= D300), R300 (= R301), M502 (= M496), W506 (= W500)
- binding flavin-adenine dinucleotide: R161 (= R170), A228 (≠ G230), G229 (= G231), N232 (vs. gap), T254 (= T255), L255 (= L256), Q256 (≠ M257), L272 (= L273), M274 (= M275), G294 (= G295), R296 (= R297), D298 (= D299), R300 (= R301), V301 (= V302), E327 (≠ D320), V328 (≠ I321), N332 (≠ S325), D346 (= D339), A347 (≠ V340), M422 (= M416), G440 (= G434), G441 (= G435)
- binding magnesium ion: D470 (≠ E464), N497 (= N491)
- binding thiamine diphosphate: E59 (= E68), P85 (= P94), V417 (= V411), G418 (= G412), Q419 (= Q413), H420 (= H414), G443 (= G437), M445 (= M439), A471 (≠ G465), S472 (= S466), N497 (= N491), E499 (≠ Y493), Q500 (≠ L494), G501 (= G495), M502 (= M496), V503 (= V497)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
43% identity, 95% coverage: 23:581/587 of query aligns to 10:574/596 of 1t9dA
- active site: Y29 (= Y42), G31 (= G44), G32 (= G45), A33 (≠ S46), I34 (≠ V47), E55 (= E68), T78 (= T91), F117 (= F130), Q118 (= Q131), E119 (= E132), K167 (= K180), R227 (= R239), M263 (= M275), V290 (= V302), V406 (= V411), L431 (= L436), G432 (= G437), M434 (= M439), D459 (≠ E464), N486 (= N491), E488 (≠ Y493), Q489 (≠ L494), M491 (= M496), V492 (= V497), W495 (= W500), L517 (= L523), G522 (= G528), L523 (≠ H529), K556 (≠ P563)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G45), A33 (≠ S46), V107 (= V120), P108 (= P121), F117 (= F130), K167 (= K180), M263 (= M275), D288 (= D300), R289 (= R301), W495 (= W500)
- binding flavin-adenine dinucleotide: R157 (= R170), G216 (= G229), A217 (≠ G230), G218 (= G231), N221 (vs. gap), T243 (= T255), L244 (= L256), Q245 (≠ M257), M260 (= M272), L261 (= L273), H264 (= H276), G283 (= G295), A284 (= A296), R285 (= R297), D287 (= D299), R289 (= R301), V290 (= V302), E316 (≠ D320), V317 (≠ I321), N321 (≠ S325), G334 (= G338), D335 (= D339), A336 (≠ V340), Q410 (= Q415), M411 (= M416), G429 (= G434), G430 (= G435)
- binding magnesium ion: D459 (≠ E464), N486 (= N491), E488 (≠ Y493)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E68), P81 (= P94), Q118 (= Q131), G432 (= G437), M434 (= M439), M464 (= M469)
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
43% identity, 95% coverage: 23:581/587 of query aligns to 10:573/595 of 1t9bB
- active site: Y29 (= Y42), G31 (= G44), G32 (= G45), A33 (≠ S46), I34 (≠ V47), E55 (= E68), T78 (= T91), F117 (= F130), Q118 (= Q131), E119 (= E132), K167 (= K180), R226 (= R239), M262 (= M275), V289 (= V302), V405 (= V411), L430 (= L436), G431 (= G437), M433 (= M439), D458 (≠ E464), N485 (= N491), E487 (≠ Y493), Q488 (≠ L494), M490 (= M496), V491 (= V497), W494 (= W500), L516 (= L523), G521 (= G528), L522 (≠ H529), K555 (≠ P563)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V120), P108 (= P121), D287 (= D300), R288 (= R301), M490 (= M496), W494 (= W500)
- binding flavin-adenine dinucleotide: R157 (= R170), G215 (= G229), A216 (≠ G230), G217 (= G231), N220 (vs. gap), T242 (= T255), L243 (= L256), Q244 (≠ M257), M259 (= M272), L260 (= L273), M262 (= M275), H263 (= H276), G282 (= G295), A283 (= A296), R284 (= R297), D286 (= D299), R288 (= R301), V289 (= V302), E315 (≠ D320), V316 (≠ I321), N320 (≠ S325), G333 (= G338), D334 (= D339), A335 (≠ V340), Q409 (= Q415), M410 (= M416), G428 (= G434), G429 (= G435)
- binding magnesium ion: D458 (≠ E464), N485 (= N491), E487 (≠ Y493)
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
43% identity, 95% coverage: 23:581/587 of query aligns to 11:575/597 of 1t9aA
- active site: Y30 (= Y42), G32 (= G44), G33 (= G45), A34 (≠ S46), I35 (≠ V47), E56 (= E68), T79 (= T91), F118 (= F130), Q119 (= Q131), E120 (= E132), K168 (= K180), R228 (= R239), M264 (= M275), V291 (= V302), V407 (= V411), L432 (= L436), G433 (= G437), M435 (= M439), D460 (≠ E464), N487 (= N491), E489 (≠ Y493), Q490 (≠ L494), M492 (= M496), V493 (= V497), W496 (= W500), L518 (= L523), G523 (= G528), L524 (≠ H529), K557 (≠ P563)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (= G45), V108 (= V120), P109 (= P121), F118 (= F130), K168 (= K180), M264 (= M275), D289 (= D300), R290 (= R301), M492 (= M496), V493 (= V497), W496 (= W500)
- binding flavin-adenine dinucleotide: R158 (= R170), G217 (= G229), A218 (≠ G230), G219 (= G231), N222 (vs. gap), T244 (= T255), L245 (= L256), Q246 (≠ M257), L262 (= L273), M264 (= M275), H265 (= H276), G284 (= G295), A285 (= A296), R286 (= R297), D288 (= D299), R290 (= R301), V291 (= V302), E317 (≠ D320), V318 (≠ I321), N322 (≠ S325), G335 (= G338), D336 (= D339), A337 (≠ V340), Q411 (= Q415), M412 (= M416), G430 (= G434), G431 (= G435)
- binding magnesium ion: D460 (≠ E464), N487 (= N491), E489 (≠ Y493)
- binding propyl trihydrogen diphosphate: V407 (= V411), G408 (= G412), Q409 (= Q413), H410 (= H414), M435 (= M439), G459 (= G463), D460 (≠ E464), A461 (≠ G465), S462 (= S466), N487 (= N491), E489 (≠ Y493), Q490 (≠ L494), G491 (= G495), M492 (= M496)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G437), M435 (= M439), M465 (= M469)
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
43% identity, 95% coverage: 23:581/587 of query aligns to 12:577/599 of 1n0hA
- active site: Y31 (= Y42), G33 (= G44), G34 (= G45), A35 (≠ S46), I36 (≠ V47), E57 (= E68), T80 (= T91), F119 (= F130), Q120 (= Q131), E121 (= E132), K169 (= K180), R230 (= R239), M266 (= M275), V293 (= V302), V409 (= V411), L434 (= L436), G435 (= G437), M437 (= M439), D462 (≠ E464), N489 (= N491), E491 (≠ Y493), Q492 (≠ L494), M494 (= M496), V495 (= V497), W498 (= W500), L520 (= L523), G525 (= G528), L526 (≠ H529), K559 (≠ P563)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (= V411), G410 (= G412), Q411 (= Q413), H412 (= H414), G435 (= G437), M437 (= M439), G461 (= G463), D462 (≠ E464), A463 (≠ G465), S464 (= S466), M467 (= M469), N489 (= N491), E491 (≠ Y493), Q492 (≠ L494), G493 (= G495), V495 (= V497)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (= G45), A35 (≠ S46), V109 (= V120), P110 (= P121), F119 (= F130), K169 (= K180), M266 (= M275), D291 (= D300), R292 (= R301), V495 (= V497), W498 (= W500)
- binding flavin-adenine dinucleotide: R159 (= R170), G219 (= G229), A220 (≠ G230), G221 (= G231), N224 (vs. gap), T246 (= T255), L247 (= L256), Q248 (≠ M257), L264 (= L273), G265 (= G274), M266 (= M275), H267 (= H276), G286 (= G295), A287 (= A296), R288 (= R297), D290 (= D299), R292 (= R301), V293 (= V302), E319 (≠ D320), V320 (≠ I321), N324 (≠ S325), G337 (= G338), D338 (= D339), A339 (≠ V340), M414 (= M416), G432 (= G434), G433 (= G435)
- binding magnesium ion: D462 (≠ E464), N489 (= N491), E491 (≠ Y493)
- binding thiamine diphosphate: Y31 (= Y42), E57 (= E68), P83 (= P94)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
42% identity, 95% coverage: 23:581/587 of query aligns to 99:661/670 of P17597
- A122 (≠ S46) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L48) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E68) binding
- S186 (= S110) binding
- P197 (= P121) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ A123) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q131) binding
- K220 (= K144) binding
- R246 (= R170) binding ; binding
- K256 (= K180) binding
- G308 (= G230) binding
- TL 331:332 (= TL 255:256) binding
- C340 (≠ A264) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 273:276) binding
- GVRFD 371:375 (≠ GARFD 295:299) binding
- DR 376:377 (= DR 300:301) binding
- DI 395:396 (= DI 320:321) binding
- DV 414:415 (= DV 339:340) binding
- QH 487:488 (= QH 413:414) binding
- GG 508:509 (= GG 434:435) binding
- GAM 511:513 (≠ GTM 437:439) binding
- D538 (≠ E464) binding
- DGS 538:540 (≠ EGS 464:466) binding
- N565 (= N491) binding
- NQHLGM 565:570 (≠ NRYLGM 491:496) binding
- H567 (≠ Y493) binding
- W574 (= W500) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ A573) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
43% identity, 95% coverage: 23:581/587 of query aligns to 10:561/583 of 1t9bA
- active site: Y29 (= Y42), G31 (= G44), G32 (= G45), A33 (≠ S46), I34 (≠ V47), E55 (= E68), T78 (= T91), F117 (= F130), Q118 (= Q131), E119 (= E132), K167 (= K180), R214 (= R239), M250 (= M275), V277 (= V302), V393 (= V411), L418 (= L436), G419 (= G437), M421 (= M439), D446 (≠ E464), N473 (= N491), E475 (≠ Y493), Q476 (≠ L494), M478 (= M496), V479 (= V497), W482 (= W500), L504 (= L523), G509 (= G528), L510 (≠ H529), K543 (≠ P563)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V120), P108 (= P121), F117 (= F130), D275 (= D300), R276 (= R301), M478 (= M496), W482 (= W500)
- binding flavin-adenine dinucleotide: R157 (= R170), G203 (= G229), A204 (≠ G230), G205 (= G231), N208 (vs. gap), T230 (= T255), L231 (= L256), Q232 (≠ M257), M247 (= M272), L248 (= L273), M250 (= M275), H251 (= H276), G270 (= G295), A271 (= A296), R272 (= R297), D274 (= D299), R276 (= R301), V277 (= V302), E303 (≠ D320), V304 (≠ I321), N308 (≠ S325), D322 (= D339), A323 (≠ V340), Q397 (= Q415), M398 (= M416), G416 (= G434), G417 (= G435)
- binding magnesium ion: D446 (≠ E464), N473 (= N491), E475 (≠ Y493)
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
42% identity, 95% coverage: 23:581/587 of query aligns to 14:576/583 of 5k3sA
- active site: Y33 (= Y42), G35 (= G44), G36 (= G45), A37 (≠ S46), S38 (≠ V47), E59 (= E68), T82 (= T91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M275), V293 (= V302), V400 (= V411), G426 (= G437), M428 (= M439), D453 (≠ E464), N480 (= N491), H482 (≠ Y493), L483 (= L494), M485 (= M496), V486 (= V497), W489 (= W500), H558 (≠ P563)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R301), M485 (= M496), W489 (= W500), G569 (= G574)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G229), G223 (= G230), G224 (= G231), T246 (= T255), L247 (= L256), M248 (= M257), L264 (= L273), M266 (= M275), G286 (= G295), R288 (= R297), D290 (= D299), V293 (= V302), D310 (= D320), I311 (= I321), D329 (= D339), V330 (= V340), M405 (= M416), G423 (= G434)
- binding magnesium ion: D453 (≠ E464), N480 (= N491), H482 (≠ Y493)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V411), G401 (= G412), Q402 (= Q413), H403 (= H414), G426 (= G437), M428 (= M439), D453 (≠ E464), G454 (= G465), S455 (= S466), N480 (= N491), H482 (≠ Y493), L483 (= L494), G484 (= G495), M485 (= M496), V486 (= V497)
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
43% identity, 95% coverage: 23:581/587 of query aligns to 9:560/582 of 1t9dB
- active site: Y28 (= Y42), G30 (= G44), G31 (= G45), A32 (≠ S46), I33 (≠ V47), E54 (= E68), T77 (= T91), F116 (= F130), Q117 (= Q131), E118 (= E132), K166 (= K180), R213 (= R239), M249 (= M275), V276 (= V302), V392 (= V411), L417 (= L436), G418 (= G437), M420 (= M439), D445 (≠ E464), N472 (= N491), E474 (≠ Y493), Q475 (≠ L494), M477 (= M496), V478 (= V497), W481 (= W500), L503 (= L523), G508 (= G528), L509 (≠ H529), K542 (≠ P563)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G31 (= G45), A32 (≠ S46), V106 (= V120), P107 (= P121), F116 (= F130), K166 (= K180), M249 (= M275), D274 (= D300), R275 (= R301), W481 (= W500)
- binding flavin-adenine dinucleotide: R156 (= R170), G202 (= G229), A203 (≠ G230), G204 (= G231), N207 (vs. gap), T229 (= T255), L230 (= L256), Q231 (≠ M257), L247 (= L273), M249 (= M275), H250 (= H276), G269 (= G295), A270 (= A296), R271 (= R297), D273 (= D299), R275 (= R301), V276 (= V302), E302 (≠ D320), V303 (≠ I321), N307 (≠ S325), G320 (= G338), D321 (= D339), A322 (≠ V340), Q396 (= Q415), M397 (= M416), G415 (= G434), G416 (= G435)
- binding magnesium ion: D445 (≠ E464), N472 (= N491), E474 (≠ Y493)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E68), P80 (= P94), G418 (= G437), M420 (= M439), M450 (= M469)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
42% identity, 95% coverage: 23:581/587 of query aligns to 13:575/582 of 3ea4A
- active site: Y32 (= Y42), G34 (= G44), G35 (= G45), A36 (≠ S46), S37 (≠ V47), E58 (= E68), T81 (= T91), F120 (= F130), Q121 (= Q131), E122 (= E132), K170 (= K180), M265 (= M275), V292 (= V302), V399 (= V411), G425 (= G437), M427 (= M439), D452 (≠ E464), N479 (= N491), H481 (≠ Y493), L482 (= L494), M484 (= M496), V485 (= V497), W488 (= W500), H557 (≠ P563)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D300), R291 (= R301), W488 (= W500), S567 (≠ A573)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R170), G221 (= G229), G222 (= G230), G223 (= G231), T245 (= T255), L246 (= L256), M247 (= M257), L263 (= L273), G264 (= G274), M265 (= M275), H266 (= H276), G285 (= G295), R287 (= R297), D289 (= D299), R291 (= R301), D309 (= D320), I310 (= I321), G327 (= G338), D328 (= D339), V329 (= V340), M404 (= M416), G422 (= G434)
- binding magnesium ion: D452 (≠ E464), N479 (= N491), H481 (≠ Y493)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V411), G400 (= G412), Q401 (= Q413), H402 (= H414), M427 (= M439), G451 (= G463), D452 (≠ E464), G453 (= G465), S454 (= S466), N479 (= N491), H481 (≠ Y493), L482 (= L494), G483 (= G495), M484 (= M496), V485 (= V497)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
42% identity, 95% coverage: 23:581/587 of query aligns to 13:575/582 of 3e9yA
- active site: Y32 (= Y42), G34 (= G44), G35 (= G45), A36 (≠ S46), S37 (≠ V47), E58 (= E68), T81 (= T91), F120 (= F130), Q121 (= Q131), E122 (= E132), K170 (= K180), M265 (= M275), V292 (= V302), V399 (= V411), G425 (= G437), M427 (= M439), D452 (≠ E464), N479 (= N491), H481 (≠ Y493), L482 (= L494), M484 (= M496), V485 (= V497), W488 (= W500), H557 (≠ P563)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D300), R291 (= R301), W488 (= W500), S567 (≠ A573)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R170), G221 (= G229), G222 (= G230), G223 (= G231), T245 (= T255), L246 (= L256), M247 (= M257), L263 (= L273), G285 (= G295), R287 (= R297), D289 (= D299), R291 (= R301), D309 (= D320), I310 (= I321), G327 (= G338), D328 (= D339), V329 (= V340), M404 (= M416), G422 (= G434)
- binding magnesium ion: D452 (≠ E464), N479 (= N491), H481 (≠ Y493)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V411), G400 (= G412), Q401 (= Q413), H402 (= H414), M427 (= M439), G451 (= G463), G453 (= G465), S454 (= S466), N479 (= N491), H481 (≠ Y493), L482 (= L494), G483 (= G495), M484 (= M496), V485 (= V497)
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
42% identity, 95% coverage: 23:581/587 of query aligns to 14:576/585 of 5k2oA
- active site: Y33 (= Y42), G35 (= G44), G36 (= G45), A37 (≠ S46), S38 (≠ V47), E59 (= E68), T82 (= T91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M275), V293 (= V302), V400 (= V411), G426 (= G437), M428 (= M439), D453 (≠ E464), N480 (= N491), H482 (≠ Y493), L483 (= L494), M485 (= M496), V486 (= V497), W489 (= W500), H558 (≠ P563)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M275), R292 (= R301), W489 (= W500), S568 (≠ A573)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G229), G223 (= G230), G224 (= G231), T246 (= T255), L247 (= L256), M248 (= M257), L264 (= L273), G286 (= G295), R288 (= R297), D290 (= D299), V293 (= V302), D310 (= D320), I311 (= I321), D329 (= D339), V330 (= V340), Q404 (= Q415), M405 (= M416), G423 (= G434)
- binding magnesium ion: D453 (≠ E464), N480 (= N491), H482 (≠ Y493)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V411), G401 (= G412), Q402 (= Q413), H403 (= H414), M428 (= M439), D453 (≠ E464), G454 (= G465), S455 (= S466), N480 (= N491), H482 (≠ Y493), L483 (= L494), G484 (= G495), M485 (= M496), V486 (= V497)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
42% identity, 95% coverage: 23:581/587 of query aligns to 14:576/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V411), G401 (= G412), Q402 (= Q413), H403 (= H414), G426 (= G437), M428 (= M439), G452 (= G463), D453 (≠ E464), G454 (= G465), S455 (= S466), M458 (= M469), N480 (= N491), H482 (≠ Y493), L483 (= L494), G484 (= G495), M485 (= M496), V486 (= V497)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G229), G223 (= G230), G224 (= G231), T246 (= T255), L247 (= L256), M248 (= M257), L264 (= L273), M266 (= M275), H267 (= H276), G286 (= G295), V287 (≠ A296), R288 (= R297), D290 (= D299), R292 (= R301), V293 (= V302), D310 (= D320), I311 (= I321), D329 (= D339), V330 (= V340), M405 (= M416), G423 (= G434)
- binding magnesium ion: F370 (= F381), D453 (≠ E464), M458 (= M469), Q461 (= Q472), N480 (= N491), H482 (≠ Y493), K533 (≠ T537)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M275), R292 (= R301), M485 (= M496), W489 (= W500), S568 (≠ A573)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
42% identity, 95% coverage: 23:581/587 of query aligns to 14:576/582 of 5wj1A
- active site: Y33 (= Y42), G35 (= G44), G36 (= G45), A37 (≠ S46), S38 (≠ V47), E59 (= E68), T82 (= T91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M275), V293 (= V302), V400 (= V411), G426 (= G437), M428 (= M439), D453 (≠ E464), N480 (= N491), H482 (≠ Y493), L483 (= L494), M485 (= M496), V486 (= V497), W489 (= W500), H558 (≠ P563)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G229), G223 (= G230), G224 (= G231), T246 (= T255), L247 (= L256), M248 (= M257), M263 (= M272), L264 (= L273), G286 (= G295), R288 (= R297), V293 (= V302), D310 (= D320), I311 (= I321), D329 (= D339), V330 (= V340), M405 (= M416), G423 (= G434), G424 (= G435)
- binding magnesium ion: D453 (≠ E464), N480 (= N491), H482 (≠ Y493)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M275), D291 (= D300), R292 (= R301), M485 (= M496), W489 (= W500), S568 (≠ A573)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V411), G401 (= G412), Q402 (= Q413), H403 (= H414), M428 (= M439), D453 (≠ E464), G454 (= G465), S455 (= S466), M458 (= M469), N480 (= N491), H482 (≠ Y493), L483 (= L494), G484 (= G495), M485 (= M496), V486 (= V497)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
42% identity, 95% coverage: 23:581/587 of query aligns to 14:576/582 of 5k6tA
- active site: Y33 (= Y42), G35 (= G44), G36 (= G45), A37 (≠ S46), S38 (≠ V47), E59 (= E68), T82 (= T91), F121 (= F130), Q122 (= Q131), E123 (= E132), K171 (= K180), M266 (= M275), V293 (= V302), V400 (= V411), G426 (= G437), M428 (= M439), D453 (≠ E464), N480 (= N491), H482 (≠ Y493), L483 (= L494), M485 (= M496), V486 (= V497), W489 (= W500), H558 (≠ P563)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H276), R292 (= R301), M485 (= M496), W489 (= W500), S568 (≠ A573)
- binding flavin-adenine dinucleotide: R161 (= R170), G222 (= G229), G223 (= G230), G224 (= G231), T246 (= T255), L247 (= L256), M248 (= M257), L264 (= L273), G286 (= G295), R288 (= R297), D290 (= D299), R292 (= R301), V293 (= V302), D310 (= D320), I311 (= I321), D329 (= D339), V330 (= V340), Q404 (= Q415), M405 (= M416), G423 (= G434)
- binding magnesium ion: D453 (≠ E464), N480 (= N491), H482 (≠ Y493)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V411), G401 (= G412), Q402 (= Q413), H403 (= H414), G426 (= G437), M428 (= M439), G452 (= G463), G454 (= G465), S455 (= S466), N480 (= N491), H482 (≠ Y493), L483 (= L494), G484 (= G495)
Query Sequence
>H281DRAFT_04551 FitnessBrowser__Burk376:H281DRAFT_04551
MNMPSAEFSTSDTTPQHEADSIGATVLMKALADEDVEFVWGYPGGSVLYIYDELYKQDKF
QHILVRHEQAAVHAADAYSRSTGKVGVCLVTSGPGVTNAVTGIATAYMDSIPMVVISGQV
PTAAIGQDAFQECDTVGITRPCVKHNFLVKDVRDLAATVKKAFYIARTGRPGPVLIDIPK
DVSKAPCQYEPIKTVSLRSYNPVTKGHSGQIRKAVSLLLSAKRPYIYTGGGIILADASRE
LNQFADLLGYPITNTLMGLGGYRASDKKFLGMLGMHGTYEANMAMQHCDVLIAIGARFDD
RVIGDPAHFASRPRKIIHIDIDPSSISKRVKVDIPIVGDVKEVLKELIEQLQTAEHGPDT
AALADWWKDIEAWRAKDCLKFDRKSDVIKPQYVVEKAWELTDGNAFVCSDVGQHQMWAAQ
FYRFNKPRRWINSGGLGTMGFGLPAAMGVKMAHPDDDVLCITGEGSIQMCIQELSTCKQY
ETPVKIISLNNRYLGMVRQWQQIEYSKRYSHSYMDALPDFVKLAEAYGHVGMRIERTADV
EPALKEALRLKDRTVFLDFQTDPTENVWPMVQAGKGITEMLMGSEDL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory