SitesBLAST
Comparing H281DRAFT_04587 FitnessBrowser__Burk376:H281DRAFT_04587 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wy8C Tcur3481-tcur3483 steroid acad (see paper)
30% identity, 98% coverage: 1:367/375 of query aligns to 1:357/364 of 6wy8C
6wy9B Tcur3481-tcur3483 steroid acad g363a variant (see paper)
30% identity, 97% coverage: 4:367/375 of query aligns to 1:354/361 of 6wy9B
6cxtB Crystal structure of fad-dependent dehydrogenase (see paper)
28% identity, 90% coverage: 1:337/375 of query aligns to 1:338/372 of 6cxtB
- active site: I117 (≠ F125), S118 (≠ H126), E234 (≠ G231)
- binding flavin-adenine dinucleotide: N115 (≠ V123), I117 (≠ F125), S118 (≠ H126), G123 (≠ R131), S124 (≠ Y132), Y148 (≠ V156), T150 (≠ L158), L201 (= L204)
- binding S-[2-({N-[(2R)-2-hydroxy-4-{[(R)-hydroxy(oxo)-lambda~5~-phosphanyl]oxy}-3,3-dimethylbutanoyl]-beta-alanyl}amino)ethyl] 1H-pyrrole-2-carbothioate: A81 (≠ V92), N115 (≠ V123), S124 (≠ Y132), F227 (≠ L224), M231 (≠ A228), E234 (≠ G231), R235 (≠ T232)
Sites not aligning to the query:
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
29% identity, 93% coverage: 1:349/375 of query aligns to 1:357/379 of 1ukwB
- active site: L124 (≠ F125), S125 (≠ H126), T241 (≠ G231)
- binding cobalt (ii) ion: D145 (≠ E146), H146 (≠ Q147)
- binding flavin-adenine dinucleotide: F122 (≠ V123), L124 (≠ F125), S125 (≠ H126), G130 (≠ R131), S131 (≠ Y132), W155 (≠ V156), S157 (≠ L158), K200 (≠ I196), L357 (≠ I349)
Sites not aligning to the query:
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
29% identity, 93% coverage: 1:349/375 of query aligns to 1:357/379 of 1ukwA
Sites not aligning to the query:
6cy8B Crystal structure of fad-dependent dehydrogenase (see paper)
27% identity, 90% coverage: 1:337/375 of query aligns to 1:336/370 of 6cy8B
- active site: I115 (≠ F125), S116 (≠ H126), E232 (≠ G231)
- binding flavin-adenine dinucleotide: N113 (vs. gap), I115 (≠ F125), S116 (≠ H126), G121 (≠ R131), S122 (≠ Y132), Y146 (≠ V156), T148 (≠ L158), L199 (= L204)
- binding 4'-phosphopantetheine: S122 (≠ Y132), F225 (≠ L224), A226 (≠ E225), R233 (≠ T232)
Sites not aligning to the query:
7szvA Crystal structure of acyl-coa dehydrogenase from mycobacterium marinum in complex with fda
27% identity, 97% coverage: 4:365/375 of query aligns to 1:367/372 of 7szvA
- binding dihydroflavine-adenine dinucleotide: L122 (≠ F125), T123 (≠ H126), F153 (≠ V156), I154 (≠ V157), T155 (≠ L158), K194 (≠ I196), R261 (= R257), S263 (≠ Q259), Y271 (≠ F267), I274 (≠ L270), Q329 (= Q327), V330 (≠ L328), G332 (= G330), G333 (= G331), T358 (≠ D356), E360 (≠ D358)
2pg0A Crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus
27% identity, 92% coverage: 5:349/375 of query aligns to 5:359/380 of 2pg0A
- active site: M124 (≠ F125), T125 (≠ H126), E243 (≠ G231)
- binding flavin-adenine dinucleotide: I122 (≠ V123), M124 (≠ F125), T125 (≠ H126), G130 (≠ R131), S131 (≠ Y132), F155 (≠ V156), I156 (≠ V157), T157 (≠ L158), R269 (= R257), F272 (= F260), F279 (= F267), Q337 (= Q327), L338 (= L328), G340 (= G330), G341 (= G331), V359 (≠ I349)
Sites not aligning to the query:
7s7gA Crystal structure analysis of human vlcad
27% identity, 97% coverage: 5:369/375 of query aligns to 26:408/571 of 7s7gA
- binding flavin-adenine dinucleotide: F146 (≠ V123), L148 (≠ F125), T149 (≠ H126), G154 (≠ R131), S155 (≠ Y132), W181 (≠ V156), I182 (≠ V157), S183 (≠ L158), I389 (= I349), T396 (≠ D356), D398 (= D358), I399 (≠ H360)
Sites not aligning to the query:
2uxwA Crystal structure of human very long chain acyl-coa dehydrogenase (acadvl)
27% identity, 97% coverage: 5:369/375 of query aligns to 26:408/567 of 2uxwA
- active site: L148 (≠ F125), T149 (≠ H126), G272 (= G231), E394 (≠ L354), L406 (= L367)
- binding flavin-adenine dinucleotide: F146 (≠ V123), L148 (≠ F125), T149 (≠ H126), G154 (≠ R131), S155 (≠ Y132), W181 (≠ V156), I182 (≠ V157), S183 (≠ L158), F393 (≠ T353), T396 (≠ D356), D398 (= D358), I399 (≠ H360)
- binding trans delta2 palmitenoyl-coenzymea: V96 (vs. gap), G107 (≠ A81), L110 (≠ V84), F146 (≠ V123), L269 (≠ A228), F393 (≠ T353), E394 (≠ L354), G395 (= G355)
Sites not aligning to the query:
3b96A Structural basis for substrate fatty-acyl chain specificity: crystal structure of human very-long-chain acyl-coa dehydrogenase (see paper)
27% identity, 97% coverage: 5:369/375 of query aligns to 26:408/554 of 3b96A
- active site: L148 (≠ F125), T149 (≠ H126), G272 (= G231), E394 (≠ L354), L406 (= L367)
- binding flavin-adenine dinucleotide: F146 (≠ V123), L148 (≠ F125), T149 (≠ H126), G154 (≠ R131), S155 (≠ Y132), W181 (≠ V156), I182 (≠ V157), S183 (≠ L158), I389 (= I349), F393 (≠ T353), T396 (≠ D356), D398 (= D358), I399 (≠ H360)
- binding tetradecanoyl-coa: V96 (vs. gap), G107 (≠ A81), F146 (≠ V123), L269 (≠ A228), F393 (≠ T353), E394 (≠ L354)
Sites not aligning to the query:
P49748 Very long-chain specific acyl-CoA dehydrogenase, mitochondrial; VLCAD; EC 1.3.8.9 from Homo sapiens (Human) (see 8 papers)
27% identity, 97% coverage: 5:369/375 of query aligns to 94:476/655 of P49748
- 214:223 (vs. 123:132, 20% identical) binding
- WIS 249:251 (≠ VVL 156:158) binding
- F458 (≠ I350) to L: in ACADVLD; loss of acyl-CoA dehydrogenase activity; Loss of FAD cofactor-binding; dbSNP:rs118204017; mutation to T: Decreased acyl-CoA dehydrogenase activity. Decreased affinity for acyl-CoA. No effect on FAD cofactor-binding.; mutation to V: Loss of acyl-CoA dehydrogenase activity. Loss of FAD cofactor-binding.; mutation to Y: Decreased acyl-CoA dehydrogenase activity. No effect on affinity for acyl-CoA. Decreased FAD cofactor-binding.
- FEG 461:463 (≠ TLG 353:355) binding
- E462 (≠ L354) active site, Proton acceptor; mutation to D: Decreased acyl-CoA dehydrogenase activity. No effect on affinity for acyl-CoA. No effect on FAD cofactor-binding.; mutation to Q: Loss of acyl-CoA dehydrogenase activity. No effect on FAD cofactor-binding.
- TND 464:466 (≠ DVD 356:358) binding
Sites not aligning to the query:
- 1:40 modified: transit peptide, Mitochondrion
- 490 A → P: in ACADVLD; decreased association with mitochondrial inner membrane; may affect substrate specificity, possibly reducing the affinity for long-chain acyl-CoA substrates; dbSNP:rs759775666; mutation A->G,V,S,D,H: Changed substrate specificity with decreased affinity for tetradecanoyl-CoA and hexadecanoyl-CoA.
- 502 L → P: in ACADVLD; decreased association with mitochondrial inner membrane; decreased specific activity towards several substrates in vitro
- 534 E → K: in ACADVLD; uncertain significance; dbSNP:rs2230180
- 562 binding
- 583 S → W: in ACADVLD; Loss of homodimerization; loss of localization to mitochondrial inner membrane; dbSNP:rs1085307648
4x28D Crystal structure of the chse4-chse5 complex from mycobacterium tuberculosis (see paper)
27% identity, 97% coverage: 1:364/375 of query aligns to 1:355/364 of 4x28D
Sites not aligning to the query:
I6Y3Q0 Acyl-CoA dehydrogenase FadE27; ACAD; 3-oxocholest-4-en-26-oyl-CoA dehydrogenase beta subunit; EC 1.3.99.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
27% identity, 97% coverage: 1:364/375 of query aligns to 1:364/373 of I6Y3Q0
- R251 (= R257) binding
- H327 (≠ Q327) binding
- G331 (= G331) binding
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
26% identity, 95% coverage: 1:355/375 of query aligns to 1:364/380 of 4l1fA
- active site: L125 (≠ F125), T126 (≠ H126), G242 (= G231), E363 (≠ L354)
- binding coenzyme a persulfide: T132 (≠ Y132), H179 (vs. gap), F232 (≠ A221), M236 (≠ E225), E237 (≠ H226), L239 (≠ A228), D240 (= D229), R243 (≠ T232), Y362 (≠ T353), E363 (≠ L354), G364 (= G355)
- binding flavin-adenine dinucleotide: F123 (≠ V123), L125 (≠ F125), T126 (≠ H126), G131 (≠ R131), T132 (≠ Y132), F156 (≠ V156), I157 (≠ V157), T158 (≠ L158), R268 (= R257), Q270 (= Q259), F271 (= F260), I275 (= I264), F278 (= F267), L281 (= L270), Q336 (= Q327), I337 (≠ L328), G340 (= G331), I358 (= I349), Y362 (≠ T353)
- binding 1,3-propandiol: L5 (≠ F5), Q10 (= Q10)
Sites not aligning to the query:
3pfdC Crystal structure of an acyl-coa dehydrogenase from mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion sad mr (see paper)
26% identity, 86% coverage: 33:355/375 of query aligns to 23:354/369 of 3pfdC
- active site: L116 (≠ F125), S117 (≠ H126), T233 (vs. gap), E353 (≠ L354)
- binding dihydroflavine-adenine dinucleotide: Y114 (≠ V123), L116 (≠ F125), S117 (≠ H126), G122 (≠ R131), S123 (≠ Y132), W147 (≠ V156), I148 (≠ V157), T149 (≠ L158), R259 (= R257), F262 (= F260), V266 (≠ I264), N269 (≠ F267), Q326 (= Q327), L327 (= L328), G330 (= G331), I348 (= I349), Y352 (≠ T353)
Sites not aligning to the query:
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
26% identity, 81% coverage: 49:351/375 of query aligns to 49:362/384 of 1jqiA
- binding acetoacetyl-coenzyme a: L95 (≠ A91), F125 (≠ V123), S134 (≠ Y132), F234 (≠ A221), M238 (≠ E225), Q239 (≠ H226), L241 (≠ A228), D242 (= D229), R245 (≠ T232)
- binding flavin-adenine dinucleotide: F125 (≠ V123), L127 (≠ F125), S128 (≠ H126), G133 (≠ R131), S134 (≠ Y132), W158 (≠ V156), T160 (≠ L158), R270 (= R257), F273 (= F260), L280 (≠ F267), Q338 (= Q327), I339 (≠ L328), G342 (= G331), I360 (= I349)
Sites not aligning to the query:
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 81% coverage: 49:351/375 of query aligns to 76:389/412 of P15651
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
- 392 active site, Proton acceptor
- 394:396 binding
4irnA Crystal structure of the prolyl acyl carrier protein oxidase anab (see paper)
23% identity, 78% coverage: 44:336/375 of query aligns to 39:345/378 of 4irnA
- active site: A124 (≠ F125), T125 (≠ H126), E241 (≠ G231)
- binding flavin-adenine dinucleotide: H122 (≠ V123), A124 (≠ F125), T125 (≠ H126), G130 (≠ R131), S131 (≠ Y132), Y155 (≠ V156), T157 (≠ L158), H267 (≠ R257), Q269 (= Q259), F270 (= F260), I274 (= I264), F277 (= F267), V280 (≠ L270), E335 (≠ Q327), I336 (≠ L328), G338 (= G330), A339 (≠ G331)
Sites not aligning to the query:
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
26% identity, 80% coverage: 51:351/375 of query aligns to 48:359/378 of 5ol2F
- active site: L124 (≠ F125), T125 (≠ H126), G241 (= G231)
- binding coenzyme a persulfide: L238 (≠ A228), R242 (≠ T232)
- binding flavin-adenine dinucleotide: F122 (≠ V123), L124 (≠ F125), T125 (≠ H126), P127 (= P128), T131 (≠ Y132), F155 (≠ V156), I156 (≠ V157), T157 (≠ L158), E198 (≠ T191), R267 (= R257), F270 (= F260), L274 (≠ I264), F277 (= F267), Q335 (= Q327), L336 (= L328), G338 (= G330), G339 (= G331)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_04587 FitnessBrowser__Burk376:H281DRAFT_04587
MDFTFNDEQQQLADALRRYLDRNYGFEARQAIVRSDAGISETHWAAFTELGLPALPVPEA
QGGFNGGAVDMLVVMQELGRALVVEPYWATAVGVEALRLAGTGQGEDASLLERAAQGEIK
LAVAFHEPKARYDLFEIATVATSQGEQHTLTGTKSVVLHGAQANYWIVPARSNGEIALFV
VPRDAAGVKITDYRTIDGQRAATLEFNGTPARQLRGQHSGAAALEHIADYGTLLLCAEAV
GALDALNTATVDYTKTRQQFGQPIARFQALQHRMVEMLIHAEQARSVTYLAAMRYSSEDA
DQRRRAISAAKVRVGQAARFVGQQAVQLHGGMGVTNEVAAAHLFKRLAIIETTLGDVDHH
LARFAALPGFASIEV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory