Comparing H281DRAFT_04625 H281DRAFT_04625 3-hydroxyacyl-CoA dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
33% identity, 36% coverage: 4:293/811 of query aligns to 25:312/314 of P00348
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
32% identity, 36% coverage: 4:293/811 of query aligns to 25:312/314 of Q16836
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
32% identity, 36% coverage: 4:293/811 of query aligns to 2:289/291 of 1f0yA
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
32% identity, 36% coverage: 4:293/811 of query aligns to 2:289/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
32% identity, 36% coverage: 4:293/811 of query aligns to 2:289/293 of 1f12A
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 35% coverage: 6:292/811 of query aligns to 5:284/286 of P9WNP7
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
30% identity, 35% coverage: 6:292/811 of query aligns to 1:278/280 of 4kuhA
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
30% identity, 35% coverage: 6:292/811 of query aligns to 1:278/282 of 4kugA
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
33% identity, 35% coverage: 6:292/811 of query aligns to 2:279/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
33% identity, 35% coverage: 6:292/811 of query aligns to 2:279/283 of 4pzdA
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
31% identity, 35% coverage: 7:292/811 of query aligns to 1:277/281 of 6aa8E
Q08426 Peroxisomal bifunctional enzyme; PBE; PBFE; L-bifunctional protein; LBP; Multifunctional enzyme 1; MFE1; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 from Homo sapiens (Human) (see 5 papers)
25% identity, 49% coverage: 6:403/811 of query aligns to 297:681/723 of Q08426
Sites not aligning to the query:
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
26% identity, 51% coverage: 6:416/811 of query aligns to 361:749/763 of P40939
Sites not aligning to the query:
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
29% identity, 35% coverage: 6:292/811 of query aligns to 336:616/731 of 4b3iA
Sites not aligning to the query:
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
29% identity, 35% coverage: 6:292/811 of query aligns to 340:620/735 of 8oqsB
Sites not aligning to the query:
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
29% identity, 35% coverage: 6:292/811 of query aligns to 333:613/727 of 8oqoA
Sites not aligning to the query:
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
29% identity, 35% coverage: 6:292/811 of query aligns to 334:614/728 of 8oqrA
Sites not aligning to the query:
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
29% identity, 35% coverage: 6:292/811 of query aligns to 328:608/723 of 8oqqA
Sites not aligning to the query:
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
29% identity, 35% coverage: 6:292/811 of query aligns to 328:608/723 of 8oqpA
Sites not aligning to the query:
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
29% identity, 35% coverage: 6:292/811 of query aligns to 334:614/729 of 8pf8A
Sites not aligning to the query:
>H281DRAFT_04625 H281DRAFT_04625 3-hydroxyacyl-CoA dehydrogenase
VSNLIIRKVAVLGAGVMGAQIAAHLINAKVPVLLFDLPAKEGPKNAIALKAIENLKKLSP
APFGVKDDAQYIQPANYDDDIEKLAECDLVIEAIAERMDWKHDLYKKVSPHIAPNAIFAT
NTSGLSITELSQGFADELKARFCGVHFFNPPRYMHLVELIPTATTRPEILDQLETFLTSV
VGKGVVRAKDTPNFIANRVGIFSILAVITEAAKFGLRFDEVDDLTGSRLGRAKSATFRTA
DVVGLDTMAHVIKTMQDNLKDDPFFPVYETPAVLAELVKKGALGQKTGGGFYRKEGKAIK
VLDPKTGDYVDGGAKADELVGRILKRPPAERLKLLRESQHPQAQFLWSIFRDVFHYIGVH
LESIADNARDVDLAIRWGFGWNEGPFEGWQTAGWKQVAEWVQEDIAAGKALSNVPLPSWV
LDGPVAEKGGVHTNEGSWSPASKTFVPRSSLGVYDRQVFRAPLVGETVADPKTYGKTLFE
TDAVRAWVDDRAGENDVLIVSFKSKMNTIGPSVIDGLTQAIELAEKEYKGLVVWQPTSLK
LGTPGGPFSAGANLEEAMPAFMMGGAKGIEPFVKKFQQGMLRVKYASVPVVSAVSGIALG
GGCELLLHSAKRVAHIESYIGLVEVGVGLVPAGGGLKEAALRAAEAATQVGATNDLLKFV
QKSFENAAMAKVSASALDARAMGYLKPSDTIVFNVFELLDVAKKEARALAGAGYRPPLRV
TQVPVAGRSAISTIKASLVNMRDGRFISEHDFVIASRIAEAVCGGDVEAGSFVDEEWLLQ
LERRAFVDLLGTQKTQERIMGMLQTGKPVRN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory