SitesBLAST
Comparing H281DRAFT_04666 FitnessBrowser__Burk376:H281DRAFT_04666 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
29% identity, 40% coverage: 32:201/425 of query aligns to 56:207/444 of Q8NLB7
- D57 (= D33) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R85) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
23% identity, 88% coverage: 14:389/425 of query aligns to 25:406/448 of Q51955
- D41 (≠ E30) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D33) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G80) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D84) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G87) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R127) mutation to A: Abolishes 4-HBA transport.
- E144 (= E147) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R193) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D298) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ T303) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (= R364) mutation to A: Strong decrease in 4-HBA transport.
- R398 (≠ G381) mutation to A: Abolishes 4-HBA transport.
Sites not aligning to the query:
- 444 H→A: No change in 4-HBA transport and chemotaxis.
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 80% coverage: 37:374/425 of query aligns to 154:499/616 of P36035
- K338 (≠ S226) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 9 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Query Sequence
>H281DRAFT_04666 FitnessBrowser__Burk376:H281DRAFT_04666
MNATTAASLAGSRRNSWRAVIAASIGNALEWFDLVVYGFFAVVIAKLFFPAGNDTVSLLL
TLGTFGVSFFMRPLGAIVIGAYADRAGRKAALTLSILLMMGGTLIIAVLPTYRSIGIAAP
VILVIARLMQGFSAGGEFGSATAFLAEHVPGRRGFFASWQVASQGLTTLLAAGFGVALTG
NLTPDQMASWGWRVPFFFGLLIGPVAWYIRTKLDETPEFLAAETTSTPLRDTFTSQKLRL
LIAIGAVVLGTVSTYLVLFMPTFGVKQLGLAPSVAFSAIALTGLIQMVFAPVVGHLSDRH
GRTTIMLISAVLLLVLIYPAFVYLVAHPTFGTLIALQVVLGFLMTGYFAALPGLLSEMFP
VQTRTTGMSLAYNIAVTVFGGFGPFIIAWLIGFTGSKAAPSYYLIFAALLSVAALIAARR
KLGFR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory