SitesBLAST
Comparing H281DRAFT_04681 FitnessBrowser__Burk376:H281DRAFT_04681 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5odqB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. (see paper)
26% identity, 54% coverage: 168:388/408 of query aligns to 2:237/291 of 5odqB
- binding Non-cubane [4Fe-4S]-cluster: G8 (= G174), C9 (= C175), C41 (= C207), C42 (= C208), C78 (≠ A247), G80 (= G249), C81 (= C250), G152 (≠ P309), C153 (= C310), H154 (≠ T311), C193 (= C342), C194 (= C343), C231 (≠ G382), F233 (≠ I384), C234 (≠ S385)
- binding 2-bromanylethanesulfonic acid: G46 (≠ R212), G80 (= G249), H154 (≠ T311), G197 (≠ A346), R201 (≠ S350), F233 (≠ I384), L236 (= L387)
5odhH Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 3.5 minutes (see paper)
26% identity, 54% coverage: 168:388/408 of query aligns to 2:237/291 of 5odhH
- binding Non-cubane [4Fe-4S]-cluster: G8 (= G174), C9 (= C175), C41 (= C207), C42 (= C208), C78 (≠ A247), G80 (= G249), C81 (= C250), C153 (= C310), H154 (≠ T311), C193 (= C342), C194 (= C343), C231 (≠ G382), F233 (≠ I384), C234 (≠ S385)
- binding 1-thioethanesulfonic acid: A44 (= A210), P45 (≠ V211), G46 (≠ R212), G80 (= G249), H154 (≠ T311), G197 (≠ A346), G198 (= G347)
- binding Coenzyme B: R201 (≠ S350), F233 (≠ I384)
Sites not aligning to the query:
5odhB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 3.5 minutes (see paper)
26% identity, 54% coverage: 168:388/408 of query aligns to 2:237/291 of 5odhB
- binding Non-cubane [4Fe-4S]-cluster: G8 (= G174), C9 (= C175), I10 (≠ V176), C41 (= C207), C42 (= C208), C78 (≠ A247), G80 (= G249), C81 (= C250), G152 (≠ P309), C153 (= C310), H154 (≠ T311), C193 (= C342), C194 (= C343), C231 (≠ G382), F233 (≠ I384), C234 (≠ S385)
- binding 1-thioethanesulfonic acid: P45 (≠ V211), G46 (≠ R212), G80 (= G249), F233 (≠ I384)
5odcB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus at 2.3 a resolution (see paper)
26% identity, 54% coverage: 168:388/408 of query aligns to 2:237/291 of 5odcB
- binding Non-cubane [4Fe-4S]-cluster: G8 (= G174), C9 (= C175), I10 (≠ V176), C41 (= C207), C42 (= C208), C78 (≠ A247), N79 (≠ S248), G80 (= G249), C81 (= C250), G152 (≠ P309), C153 (= C310), C193 (= C342), C194 (= C343), G197 (≠ A346), C231 (≠ G382), F233 (≠ I384), C234 (≠ S385)
Q9YHT2 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; Iron-sulfur subunit of complex II; Ip; EC 1.3.5.1 from Gallus gallus (Chicken) (see 2 papers)
29% identity, 23% coverage: 8:101/408 of query aligns to 180:279/290 of Q9YHT2
- C196 (= C25) binding
- C199 (= C28) binding
- C202 (= C31) binding
- C206 (= C35) binding
- W211 (≠ L40) binding
- C253 (= C75) binding
- C259 (= C81) binding
- C263 (= C85) binding
Sites not aligning to the query:
- 103 binding
- 108 binding
- 111 binding
- 123 binding
5t61L Tungsten formylmethanofuran dehydrogenase subunit fwdF (see paper)
30% identity, 20% coverage: 23:105/408 of query aligns to 68:139/348 of 5t61L
- binding iron/sulfur cluster: C70 (= C25), V71 (= V26), L72 (≠ H27), C73 (= C28), G74 (= G29), C76 (= C31), C80 (= C35), L85 (= L41), C114 (= C75), C117 (= C78), K118 (≠ R79), C120 (= C81), C124 (= C85), I129 (≠ V95)
Sites not aligning to the query:
- binding iron/sulfur cluster: 30, 31, 32, 33, 34, 36, 40, 41, 146, 153, 156, 159, 163, 164, 168, 186, 193, 195, 196, 197, 199, 203, 204, 208, 212, 215, 238, 239, 240, 241, 242, 244, 248, 249, 270, 272, 273, 274, 276, 280, 281, 284, 307, 308, 309, 310, 311, 313, 317
1yq3B Avian respiratory complex ii with oxaloacetate and ubiquinone (see paper)
29% identity, 23% coverage: 8:101/408 of query aligns to 137:236/242 of 1yq3B
- binding fe3-s4 cluster: C163 (= C35), Y173 (≠ L45), P176 (= P48), C210 (= C75), T212 (= T77), I213 (≠ C78), M214 (≠ R79), N215 (= N80), C216 (= C81)
- binding iron/sulfur cluster: C153 (= C25), I154 (≠ V26), L155 (≠ H27), C156 (= C28), A157 (≠ G29), C159 (= C31), A177 (≠ R49), C220 (= C85), P221 (= P86)
- binding Coenzyme Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-isomer: P164 (= P36), W168 (≠ L40), I213 (≠ C78)
Sites not aligning to the query:
6mysB Avian mitochondrial complex ii with atpenin a5 bound, sidechain outside (see paper)
29% identity, 23% coverage: 8:101/408 of query aligns to 135:234/240 of 6mysB
- binding 3-[(2s,4s,5r)-5,6-dichloro-2,4-dimethyl-1-oxohexyl]-4-hydroxy-5,6-dimethoxy-2(1h)-pyridinone: P162 (= P36), W166 (≠ L40), H209 (≠ L76), I211 (≠ C78)
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85)
Sites not aligning to the query:
6myrB Avian mitochondrial complex ii with thiapronil bound (see paper)
29% identity, 23% coverage: 8:101/408 of query aligns to 135:234/240 of 6myrB
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), H209 (≠ L76), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding thiapronil: P162 (= P36), W166 (≠ L40), H209 (≠ L76), I211 (≠ C78)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85)
Sites not aligning to the query:
6mypB Avian mitochondrial complex ii with ttfa (thenoyltrifluoroacetone) bound (see paper)
29% identity, 23% coverage: 8:101/408 of query aligns to 135:234/240 of 6mypB
- binding fe3-s4 cluster: C161 (= C35), C208 (= C75), H209 (≠ L76), T210 (= T77), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85)
- binding 4,4,4-trifluoro-1-thien-2-ylbutane-1,3-dione: P162 (= P36), W166 (≠ L40), H209 (≠ L76)
Sites not aligning to the query:
6myoB Avian mitochondrial complex ii with flutolanyl bound (see paper)
29% identity, 23% coverage: 8:101/408 of query aligns to 135:234/240 of 6myoB
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding N-[3-(1-methylethoxy)phenyl]-2-(trifluoromethyl)benzamide: W166 (≠ L40), H209 (≠ L76), I211 (≠ C78)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85)
Sites not aligning to the query:
2fbwB Avian respiratory complex ii with carboxin bound (see paper)
29% identity, 23% coverage: 8:101/408 of query aligns to 135:234/240 of 2fbwB
- binding 2-methyl-n-phenyl-5,6-dihydro-1,4-oxathiine-3-carboxamide: P162 (= P36), W166 (≠ L40), H209 (≠ L76)
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), C157 (= C31), A175 (≠ R49), C218 (= C85), P219 (= P86)
Sites not aligning to the query:
Q007T0 Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; Iron-sulfur subunit of complex II; Ip; EC 1.3.5.1 from Sus scrofa (Pig) (see paper)
29% identity, 21% coverage: 22:107/408 of query aligns to 183:279/280 of Q007T0
- C186 (= C25) binding
- C189 (= C28) binding
- C192 (= C31) binding
- C196 (= C35) binding
- W201 (≠ L40) binding
- C243 (= C75) binding
- C249 (= C81) binding
- C253 (= C85) binding
Sites not aligning to the query:
- 93 binding
- 98 binding
- 101 binding
- 113 binding
6myqB Avian mitochondrial complex ii with ferulenol bound (see paper)
29% identity, 23% coverage: 8:101/408 of query aligns to 134:233/239 of 6myqB
- binding 4-oxidanyl-3-[(2~{E},6~{E})-3,7,11-trimethyldodeca-2,6,10-trienyl]chromen-2-one: W165 (≠ L40), I210 (≠ C78)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (≠ R49), C217 (= C85), P218 (= P86)
Sites not aligning to the query:
3sfeB Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and thiabendazole (see paper)
29% identity, 20% coverage: 22:101/408 of query aligns to 148:234/240 of 3sfeB
- binding fe3-s4 cluster: C161 (= C35), Y171 (≠ L45), P174 (= P48), C208 (= C75), T210 (= T77), I211 (≠ C78), M212 (≠ R79), N213 (= N80), C214 (= C81)
- binding iron/sulfur cluster: C151 (= C25), I152 (≠ V26), L153 (≠ H27), C154 (= C28), A155 (≠ G29), C157 (= C31), A175 (≠ R49), C218 (= C85), P219 (= P86), K220 (≠ S87), L222 (≠ V89)
- binding 2-(1,3-thiazol-4-yl)-1h-benzimidazole: H209 (≠ L76), I211 (≠ C78)
Sites not aligning to the query:
3sfdB Crystal structure of porcine mitochondrial respiratory complex ii bound with oxaloacetate and pentachlorophenol (see paper)
29% identity, 20% coverage: 22:101/408 of query aligns to 147:233/239 of 3sfdB
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding pentachlorophenol: P161 (= P36), W165 (≠ L40), I210 (≠ C78)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (≠ R49), C217 (= C85), P218 (= P86), K219 (≠ S87)
Sites not aligning to the query:
3aegB Crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-iodo-benzamide
29% identity, 20% coverage: 22:101/408 of query aligns to 147:233/239 of 3aegB
- binding N-biphenyl-3-yl-2-iodobenzamide: S162 (≠ T37), W164 (≠ Q39), W165 (≠ L40), H208 (≠ L76)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), I210 (≠ C78), M211 (≠ R79), C213 (= C81), I227 (≠ V95)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), A174 (≠ R49), C217 (= C85)
Sites not aligning to the query:
3aeeB Crystal structure of porcine heart mitochondrial complex ii bound with atpenin a5
29% identity, 20% coverage: 22:101/408 of query aligns to 147:233/239 of 3aeeB
- binding 3-[(2s,4s,5r)-5,6-dichloro-2,4-dimethyl-1-oxohexyl]-4-hydroxy-5,6-dimethoxy-2(1h)-pyridinone: W165 (≠ L40), H208 (≠ L76), I210 (≠ C78)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), T209 (= T77), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding iron/sulfur cluster: C150 (= C25), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (≠ R49), C217 (= C85), P218 (= P86), L221 (≠ V89)
Sites not aligning to the query:
3aedB Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-phenyl-benzamide
29% identity, 20% coverage: 22:101/408 of query aligns to 147:233/239 of 3aedB
- binding 2-iodo-N-phenylbenzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L76), I210 (≠ C78)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), A154 (≠ G29), C156 (= C31), C217 (= C85), L221 (≠ V89)
Sites not aligning to the query:
3aecB Crystal structure of porcine heart mitochondrial complex ii bound with 2-iodo-n-(1-methylethyl)-benzamid
29% identity, 20% coverage: 22:101/408 of query aligns to 147:233/239 of 3aecB
- binding 2-iodo-N-(1-methylethyl)benzamide: P161 (= P36), W165 (≠ L40), H208 (≠ L76)
- binding fe3-s4 cluster: C160 (= C35), Y170 (≠ L45), P173 (= P48), C207 (= C75), I210 (≠ C78), M211 (≠ R79), N212 (= N80), C213 (= C81)
- binding iron/sulfur cluster: C150 (= C25), I151 (≠ V26), L152 (≠ H27), C153 (= C28), C156 (= C31), A174 (≠ R49), C217 (= C85), P218 (= P86), L221 (≠ V89)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_04681 FitnessBrowser__Burk376:H281DRAFT_04681
MQTNLADFIRNTPDGDEADAILRNCVHCGFCTATCPTYQLLGDELDGPRGRIYLIKQMVE
GAEVTRSTQVHLDRCLTCRNCESTCPSGVQYGKLVEIGRKITEKKVTRPLGQRLTRRFLA
SFVPNSALFTPAMRLGQHFRALLPRKLRDKVPARQRPLEWPTARHTRKMLMLAGCVQPSM
MPNVNVATARVLDALGVETLVAPDAGCCGAVRLHLGYNDEALVDMRANIDAWWPYVEQGV
EAIVMNASGCGATVKEYAHLLRHDPAYAEKARRIVELTRDIAEILPDFEEQLASITRRRA
IHTVAFHPPCTLQHGQQVRGTVEHLLTRLGVEVRLPADNHLCCGSAGTYSLTQPRLSYAL
RDQKLERLHAQEPQMIVSANVGCISHLQSGTSTPVAHWIELVEHMLSV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory