SitesBLAST
Comparing H281DRAFT_04682 FitnessBrowser__Burk376:H281DRAFT_04682 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
34% identity, 38% coverage: 41:179/362 of query aligns to 90:226/467 of 7qh2C
- binding flavin-adenine dinucleotide: P137 (≠ F91), G138 (= G92), E139 (≠ P93), A142 (= A95), T143 (= T96), G146 (= G99), N147 (≠ C100), S149 (≠ A102), T150 (≠ A103), A152 (≠ I105), G153 (≠ A106), E203 (≠ L156), G204 (= G157), I209 (= I162)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 73, 75, 76, 77, 78, 79, 80, 83, 84, 422, 423
- binding fe (iii) ion: 377, 384, 422
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
30% identity, 52% coverage: 4:192/362 of query aligns to 51:236/465 of 3pm9A
- active site: A149 (≠ I105), L159 (≠ A115)
- binding flavin-adenine dinucleotide: P69 (≠ V26), Q70 (≠ R27), G71 (= G28), G72 (= G29), N73 (≠ G30), T74 (= T31), G75 (≠ K32), L76 (≠ D33), G79 (= G36), Q80 (= Q37), L91 (≠ T46), L133 (≠ F91), G134 (= G92), A135 (≠ P93), C139 (≠ A95), T140 (= T96), G142 (= G98), G143 (= G99), S146 (≠ A102), T147 (≠ A103), A149 (≠ I105), G150 (≠ A106), E200 (≠ L156), G201 (= G157), I205 (≠ L161), I206 (= I162)
Sites not aligning to the query:
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
27% identity, 47% coverage: 11:179/362 of query aligns to 53:221/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 45% coverage: 29:192/362 of query aligns to 98:263/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
5ae3A Ether lipid-generating enzyme agps in complex with antimycin a (see paper)
27% identity, 48% coverage: 4:176/362 of query aligns to 122:294/539 of 5ae3A
- binding flavin-adenine dinucleotide: P140 (≠ V26), I141 (≠ R27), G142 (= G28), G143 (= G29), G144 (= G30), T145 (= T31), S146 (≠ K32), V147 (≠ D33), L151 (≠ Q37), P208 (= P88), D209 (≠ P89), S210 (≠ H90), S214 (≠ A95), T215 (= T96), G218 (= G99), W219 (≠ C100), S221 (≠ A102), T222 (≠ A103), A224 (≠ I105), S225 (≠ A106), E274 (≠ L156), V279 (≠ L161), I280 (= I162)
Sites not aligning to the query:
- binding [(2R,3S,6S,7R,8R)-3-[(3-formamido-2-oxidanyl-phenyl)carbonylamino]-8-hexyl-2,6-dimethyl-4,9-bis(oxidanylidene)-1,5-dioxonan-7-yl] 3-methylbutanoate: 45, 49, 53, 325, 327, 331, 334, 349, 386, 393, 396, 400, 447, 461
- binding flavin-adenine dinucleotide: 497
5adzC Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
27% identity, 48% coverage: 4:176/362 of query aligns to 136:308/557 of 5adzC
- binding flavin-adenine dinucleotide: P154 (≠ V26), I155 (≠ R27), G156 (= G28), G157 (= G29), G158 (= G30), T159 (= T31), S160 (≠ K32), P222 (= P88), D223 (≠ P89), S224 (≠ H90), S228 (≠ A95), T229 (= T96), G232 (= G99), W233 (≠ C100), S235 (≠ A102), T236 (≠ A103), A238 (≠ I105), S239 (≠ A106), E288 (≠ L156), G289 (= G157), I294 (= I162)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D223 (≠ P89)
Sites not aligning to the query:
6gouA Development of alkyl glycerone phosphate synthase inhibitors: complex with inhibitor 2i (see paper)
27% identity, 48% coverage: 4:176/362 of query aligns to 136:308/554 of 6gouA
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: D223 (≠ P89)
- binding flavin-adenine dinucleotide: P154 (≠ V26), I155 (≠ R27), G156 (= G28), G157 (= G29), G158 (= G30), T159 (= T31), S160 (≠ K32), V161 (≠ D33), G164 (= G36), P222 (= P88), D223 (≠ P89), S224 (≠ H90), S228 (≠ A95), T229 (= T96), G232 (= G99), W233 (≠ C100), S235 (≠ A102), T236 (≠ A103), A238 (≠ I105), S239 (≠ A106), E288 (≠ L156), V293 (≠ L161), I294 (= I162)
Sites not aligning to the query:
4bc9A Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
27% identity, 48% coverage: 4:176/362 of query aligns to 127:299/555 of 4bc9A
- binding propanenitrile: D214 (≠ P89)
- binding flavin-adenine dinucleotide: P145 (≠ V26), I146 (≠ R27), G147 (= G28), G148 (= G29), G149 (= G30), T150 (= T31), S151 (≠ K32), V152 (≠ D33), G155 (= G36), L156 (≠ Q37), P213 (= P88), D214 (≠ P89), S215 (≠ H90), S219 (≠ A95), T220 (= T96), G223 (= G99), W224 (≠ C100), S226 (≠ A102), T227 (≠ A103), A229 (≠ I105), S230 (≠ A106), E279 (≠ L156), V284 (≠ L161), I285 (= I162)
Sites not aligning to the query:
P97275 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Cavia porcellus (Guinea pig) (see 4 papers)
27% identity, 48% coverage: 4:176/362 of query aligns to 216:388/658 of P97275
- 234:240 (vs. 26:32, 57% identical) binding
- H300 (≠ F86) mutation to A: Loss of activity.
- 303:309 (vs. 89:96, 13% identical) binding
- T309 (= T96) mutation to I: Impaired FAD binding and protein stability. Loss of activity.
- TRAS 316:319 (≠ AGIA 103:106) binding
- S367 (= S155) mutation to A: Strongly reduced activity.
- 368:374 (vs. 156:162, 71% identical) binding
Sites not aligning to the query:
- 1:58 modified: transit peptide, Peroxisome
- 419 Important for enzyme activity; R→H: Loss of activity.; R→K: Strongly reduced activity.
- 469 L→P: Impaired FAD binding and protein stability. Loss of activity.
- 515 binding ; R→L: Impaired FAD binding and protein stability. Loss of activity.
- 576 C→A: No effect on activity.
- 578 active site, Proton donor/acceptor; Y→F: Loss of activity.
- 615 H→A: Loss of activity.
- 615:617 Important for enzyme activity
- 616 H→A: Loss of activity.
- 617 H→A: Loss of activity.
- 654:658 Important for enzyme activity
5ae1B Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
27% identity, 48% coverage: 4:176/362 of query aligns to 122:294/539 of 5ae1B
- binding flavin-adenine dinucleotide: P140 (≠ V26), I141 (≠ R27), G142 (= G28), G143 (= G29), G144 (= G30), T145 (= T31), S146 (≠ K32), G150 (= G36), L151 (≠ Q37), P208 (= P88), D209 (≠ P89), S210 (≠ H90), S214 (≠ A95), T215 (= T96), G218 (= G99), W219 (≠ C100), S221 (≠ A102), T222 (≠ A103), A224 (≠ I105), S225 (≠ A106), E274 (≠ L156), V279 (≠ L161), I280 (= I162)
Sites not aligning to the query:
4bc9B Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
27% identity, 48% coverage: 4:176/362 of query aligns to 122:294/542 of 4bc9B
- binding propanenitrile: D209 (≠ P89)
- binding flavin-adenine dinucleotide: P140 (≠ V26), G142 (= G28), G143 (= G29), G144 (= G30), T145 (= T31), S146 (≠ K32), V147 (≠ D33), G150 (= G36), L151 (≠ Q37), P208 (= P88), D209 (≠ P89), S210 (≠ H90), S214 (≠ A95), T215 (= T96), G218 (= G99), W219 (≠ C100), S221 (≠ A102), T222 (≠ A103), A224 (≠ I105), S225 (≠ A106), E274 (≠ L156), G275 (= G157), I280 (= I162)
Sites not aligning to the query:
5ae2B Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
27% identity, 48% coverage: 4:176/362 of query aligns to 122:294/542 of 5ae2B
- binding flavin-adenine dinucleotide: P140 (≠ V26), G142 (= G28), G143 (= G29), G144 (= G30), T145 (= T31), S146 (≠ K32), G150 (= G36), L151 (≠ Q37), P208 (= P88), D209 (≠ P89), S210 (≠ H90), S214 (≠ A95), T215 (= T96), G218 (= G99), W219 (≠ C100), S221 (≠ A102), T222 (≠ A103), A224 (≠ I105), S225 (≠ A106), E274 (≠ L156), G275 (= G157), V279 (≠ L161), I280 (= I162)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 500
- binding 3-(2-fluorophenyl)-2-methyl-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)acrylamide: 399, 409, 410, 411, 462, 464, 466, 500, 501
4bc7B Mammalian alkyldihydroxyacetonephosphate synthase: arg419his mutant (see paper)
27% identity, 48% coverage: 4:176/362 of query aligns to 122:294/543 of 4bc7B
- binding flavin-adenine dinucleotide: P140 (≠ V26), G142 (= G28), G143 (= G29), G144 (= G30), T145 (= T31), S146 (≠ K32), V147 (≠ D33), G150 (= G36), L151 (≠ Q37), P208 (= P88), D209 (≠ P89), S210 (≠ H90), S214 (≠ A95), T215 (= T96), G218 (= G99), S221 (≠ A102), T222 (≠ A103), A224 (≠ I105), S225 (≠ A106), E274 (≠ L156), G275 (= G157), I280 (= I162)
Sites not aligning to the query:
5ae2A Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
27% identity, 48% coverage: 4:176/362 of query aligns to 127:299/561 of 5ae2A
- binding flavin-adenine dinucleotide: P145 (≠ V26), I146 (≠ R27), G147 (= G28), G148 (= G29), G149 (= G30), T150 (= T31), S151 (≠ K32), G155 (= G36), L156 (≠ Q37), P213 (= P88), D214 (≠ P89), S215 (≠ H90), S219 (≠ A95), T220 (= T96), G223 (= G99), W224 (≠ C100), S226 (≠ A102), T227 (≠ A103), A229 (≠ I105), S230 (≠ A106), E279 (≠ L156), V284 (≠ L161), I285 (= I162)
Sites not aligning to the query:
5adzA Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
27% identity, 48% coverage: 4:176/362 of query aligns to 124:296/566 of 5adzA
- binding flavin-adenine dinucleotide: P142 (≠ V26), I143 (≠ R27), G144 (= G28), G145 (= G29), G146 (= G30), T147 (= T31), S148 (≠ K32), G152 (= G36), P210 (= P88), D211 (≠ P89), S212 (≠ H90), S216 (≠ A95), T217 (= T96), G220 (= G99), W221 (≠ C100), S223 (≠ A102), T224 (≠ A103), A226 (≠ I105), S227 (≠ A106), E276 (≠ L156), G277 (= G157), V281 (≠ L161), I282 (= I162)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D211 (≠ P89)
Sites not aligning to the query:
5ae1A Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
27% identity, 48% coverage: 4:176/362 of query aligns to 121:293/560 of 5ae1A
- binding flavin-adenine dinucleotide: P139 (≠ V26), I140 (≠ R27), G141 (= G28), G142 (= G29), G143 (= G30), T144 (= T31), S145 (≠ K32), V146 (≠ D33), G149 (= G36), L150 (≠ Q37), P207 (= P88), D208 (≠ P89), S209 (≠ H90), S213 (≠ A95), T214 (= T96), G216 (= G98), G217 (= G99), W218 (≠ C100), S220 (≠ A102), T221 (≠ A103), A223 (≠ I105), S224 (≠ A106), E273 (≠ L156), G274 (= G157), V278 (≠ L161), I279 (= I162)
Sites not aligning to the query:
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
26% identity, 46% coverage: 11:175/362 of query aligns to 113:278/521 of Q8N465
- N127 (≠ R25) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G29) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (= I43) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ Y49) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ T68) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A85) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A102) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ G128) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G130) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 109 S → W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 375 D → Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- 386 binding ; binding ; binding ; R→A: Loss of catalytic activity.
- 390 binding ; binding ; T→A: Significantly reduced catalytic activity.
- 399 V → M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- 401 binding ; binding ; K→A: Loss of catalytic activity.
- 419 R → H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- 426 A → T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- 434 binding ; H→A: Loss of catalytic activity.
- 436 G → V: slight reduction in catalytic activity
- 439 N → D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- 441 binding ; H→A: Loss of catalytic activity.
- 443 binding ; N→A: Significantly reduced catalytic activity.
- 444 V → A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- 446 A → V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- 475 binding ; E→A: Loss of catalytic activity.
- 476 binding ; binding ; binding ; H→A: Loss of catalytic activity.
- 477 G → R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
27% identity, 46% coverage: 11:175/362 of query aligns to 60:225/466 of 6lpxA
- binding flavin-adenine dinucleotide: P75 (≠ V26), Q76 (≠ R27), G77 (= G28), G78 (= G29), N79 (≠ G30), T80 (= T31), G81 (≠ K32), M82 (≠ D33), G85 (= G36), S86 (≠ Q37), L139 (≠ F91), G140 (= G92), A141 (≠ P93), C145 (vs. gap), G149 (= G99), N150 (≠ C100), A152 (= A102), T153 (≠ A103), G157 (= G107), G207 (= G157), I212 (= I162)
Sites not aligning to the query:
- binding 2-oxoglutaric acid: 333, 337, 348, 379, 381, 388, 423
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding zinc ion: 381, 388, 422
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
27% identity, 46% coverage: 11:175/362 of query aligns to 60:225/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (≠ V26), G77 (= G28), G78 (= G29), N79 (≠ G30), T80 (= T31), G81 (≠ K32), G85 (= G36), S86 (≠ Q37), L139 (≠ F91), G140 (= G92), A141 (≠ P93), C145 (vs. gap), H146 (vs. gap), G148 (= G98), G149 (= G99), N150 (≠ C100), A152 (= A102), T153 (≠ A103), A155 (≠ I105), E206 (≠ L156), G207 (= G157), I211 (≠ L161), I212 (= I162)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding (2s)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 423
- binding zinc ion: 381, 388, 422
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
27% identity, 46% coverage: 11:175/362 of query aligns to 60:225/466 of 6lpqA
- binding flavin-adenine dinucleotide: P75 (≠ V26), G77 (= G28), G78 (= G29), N79 (≠ G30), T80 (= T31), G81 (≠ K32), G85 (= G36), S86 (≠ Q37), L139 (≠ F91), G140 (= G92), A141 (≠ P93), C145 (vs. gap), H146 (vs. gap), G149 (= G99), N150 (≠ C100), A152 (= A102), T153 (≠ A103), A155 (≠ I105), G157 (= G107), E206 (≠ L156), G207 (= G157), I211 (≠ L161), I212 (= I162)
- binding d-malate: M82 (≠ D33)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding d-malate: 333, 337, 348, 379, 381, 388, 422, 423
- binding zinc ion: 381, 388, 422
Query Sequence
>H281DRAFT_04682 FitnessBrowser__Burk376:H281DRAFT_04682
MEEDDIVAMWSERVRSASAAGRALRVRGGGTKDWYGQTLEGEILDTRAYRGIIAYDPAEL
VITARAGTPLLEIEAALAEHHQMLAFEPPHFGPQATFGGCIAAGIAGPRRPSAGAARDFV
LGAVVMNGQGQALHFGGQVVKNVAGYDVSRLMAGSLGTLGLILELSVKVLPQPQAEATLK
FDVNGTDAVRKLNEWGGRPLPITASAWRHGTLAVRLAGAESAVKSARASLGGEVVDAVEA
ERFWAGLREQTDTFFAAIPPKAALWRLALPSITEPLQLPGAQLMEWGGAQRWWITDTDAQ
TVRISAKQAGGHATIFRTGHGYDRGAGVFTPLPAPLMKIHRGLKTAFDPARIFNRGRLYP
DF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory