SitesBLAST
Comparing H281DRAFT_04683 FitnessBrowser__Burk376:H281DRAFT_04683 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
29% identity, 90% coverage: 20:468/497 of query aligns to 11:462/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P82), G75 (= G84), S76 (≠ A85), G77 (= G86), T78 (= T87), G79 (= G88), L80 (= L89), A83 (≠ G92), C84 (≠ A93), P137 (= P146), G138 (≠ S147), E139 (≠ S148), A142 (= A151), T143 (= T153), G146 (= G156), N147 (= N157), S149 (= S159), T150 (≠ E160), A152 (≠ S162), G153 (= G163), E203 (= E212), G204 (= G213), I209 (≠ V218), E422 (= E428), H423 (= H429)
- binding fe (iii) ion: H377 (= H384), H384 (= H391), E422 (= E428)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 83% coverage: 54:466/497 of query aligns to 40:452/459 of P9WIT1
- K354 (≠ P363) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:453/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R335), H369 (= H384), H376 (= H391), H414 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), W322 (≠ F339), E413 (= E428), H414 (= H429), N450 (= N465)
- binding manganese (ii) ion: H369 (= H384), H376 (= H391), E413 (= E428)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:453/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), W322 (≠ F339), E413 (= E428), H414 (= H429), N450 (= N465)
- binding lactic acid: R318 (= R335), H369 (= H384), H376 (= H391), H414 (= H429)
- binding manganese (ii) ion: H369 (= H384), H376 (= H391), E413 (= E428)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:454/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), W323 (≠ F339), E414 (= E428), H415 (= H429), N451 (= N465)
- binding manganese (ii) ion: H370 (= H384), H377 (= H391), E414 (= E428)
- binding pyruvic acid: R319 (= R335), H370 (= H384), H377 (= H391), H415 (= H429)
Sites not aligning to the query:
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:452/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L89), R317 (= R335), W321 (≠ F339), H368 (= H384), H375 (= H391), H413 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), W321 (≠ F339), Y322 (≠ P340), E412 (= E428), H413 (= H429), N449 (= N465)
- binding manganese (ii) ion: H368 (= H384), H375 (= H391), E412 (= E428)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:453/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R335), W322 (≠ F339), H369 (= H384), H376 (= H391), H414 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), W322 (≠ F339), E413 (= E428), N450 (= N465)
- binding manganese (ii) ion: H369 (= H384), H376 (= H391), E413 (= E428)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:453/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), H369 (= H384), E413 (= E428), N450 (= N465)
- binding deaminohydroxyvaline: R319 (= R335), H414 (= H429)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:453/455 of 8jdxA
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), W322 (≠ F339), E413 (= E428), H414 (= H429), N450 (= N465)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R335), H369 (= H384), H376 (= H391), H414 (= H429)
- binding manganese (ii) ion: H369 (= H384), H376 (= H391), E413 (= E428)
Sites not aligning to the query:
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:454/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), Y324 (≠ P340), H370 (= H384), E414 (= E428), N451 (= N465)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R335), W323 (≠ F339), H415 (= H429)
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:454/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R335), W323 (≠ F339), H370 (= H384), H415 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), H370 (= H384), E414 (= E428), N451 (= N465)
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:454/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R335), W323 (≠ F339), H415 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), Y324 (≠ P340), H370 (= H384), E414 (= E428), N451 (= N465)
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:454/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), H370 (= H384), E414 (= E428), N451 (= N465)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R335), W323 (≠ F339), H415 (= H429)
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:454/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), H370 (= H384), E414 (= E428), N451 (= N465)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R335), H415 (= H429)
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:454/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), Y324 (≠ P340), H370 (= H384), E414 (= E428), N451 (= N465)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L89), R319 (= R335), W323 (≠ F339), H415 (= H429)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:452/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R335), W322 (≠ F339), H369 (= H384), H376 (= H391), H413 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), W322 (≠ F339), E412 (= E428), H413 (= H429), N449 (= N465)
- binding manganese (ii) ion: H369 (= H384), H376 (= H391), E412 (= E428)
Sites not aligning to the query:
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
29% identity, 84% coverage: 54:468/497 of query aligns to 40:452/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R335), W322 (≠ F339), S336 (≠ C351), H369 (= H384), H376 (= H391), H413 (= H429)
- binding flavin-adenine dinucleotide: P68 (= P82), G70 (= G84), T71 (≠ A85), G72 (= G86), T73 (= T87), G74 (= G88), G78 (= G92), V79 (≠ A93), L90 (= L104), P132 (= P146), G133 (≠ S147), A134 (≠ S148), G140 (= G156), M141 (≠ N157), A143 (≠ S159), T144 (≠ E160), A146 (≠ S162), S147 (≠ G163), E200 (= E212), G201 (= G213), I206 (≠ V218), E412 (= E428), N449 (= N465)
- binding manganese (ii) ion: H369 (= H384), H376 (= H391), E412 (= E428)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
28% identity, 91% coverage: 18:468/497 of query aligns to 5:463/465 of 3pm9A
- active site: A149 (≠ S162), L159 (= L172)
- binding flavin-adenine dinucleotide: P69 (= P82), Q70 (≠ R83), G71 (= G84), G72 (≠ A85), N73 (≠ G86), T74 (= T87), G75 (= G88), L76 (= L89), G79 (= G92), Q80 (≠ A93), L91 (= L104), L133 (≠ P146), G134 (≠ S147), A135 (≠ S148), C139 (= C152), T140 (= T153), G142 (= G155), G143 (= G156), S146 (= S159), T147 (≠ E160), A149 (≠ S162), G150 (= G163), E200 (= E212), G201 (= G213), I205 (= I217), I206 (≠ V218), E423 (= E428)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 94% coverage: 5:470/497 of query aligns to 8:496/496 of P39976
- K17 (≠ Q14) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
25% identity, 88% coverage: 37:474/497 of query aligns to 83:521/521 of Q8N465
- S109 (≠ E63) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V81) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (≠ A85) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V101) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ F107) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- 169:521 (vs. 123:474, 25% identical) natural variant: Missing (in D2HGA1; uncertain significance)
- C172 (≠ V126) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A143) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ S159) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ M185) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G187) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ E325) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R335) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ F339) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ Y349) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- 400:521 (vs. 350:474, 26% identical) natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- K401 (≠ C351) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ E369) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (= A376) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H384) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G386) to V: slight reduction in catalytic activity
- N439 (= N389) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H391) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ L393) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I394) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (= A407) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E428) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H429) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G430) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
Query Sequence
>H281DRAFT_04683 FitnessBrowser__Burk376:H281DRAFT_04683
MNAPAELSAEVLAQRQREVVQALMAVLPNHCLLYRDEDTVAYDCDGLAAYRRLPLAVALP
ETESQVQRIVQICHRLGVPIVPRGAGTGLSGGAMPIRHGVVVSLARFRKIIEVDSYARTA
TVQPGVRNLSISEAAAPYGLYYAPDPSSQIACTIGGNVSENSGGVHCLKYGLTVHNVLRV
RAVTMEGEIVEFGSLAPDAPGLDLLAVLIGSEGMFAIVTEVTVKLIPKPQTAQVIMASFD
DVVKGGDAVAGIVAAGIIPAGLEMMDKPATRAVEEFVHAGYDLDAAAILLCESDGTPEEV
ADEIVRMTAVLREHGATRIQISRTENERLRFWSGRKNAFPAAGRISPDYYCMDGTVPRRS
IGPLLSRIEEMEKKYALRCINVFHAGDGNMHPLILFNGNDQDEWHRAEAFGCDILEACVE
LGGTVTGEHGVGIEKINSMCVQFSPEERDAFHAVKRAFDPPGLLNPDKGIPTRARCAEYG
KMHVRGGLLPHPELPRF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory