SitesBLAST
Comparing H281DRAFT_04693 FitnessBrowser__Burk376:H281DRAFT_04693 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A7B3 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Escherichia coli (strain K12) (see paper)
38% identity, 96% coverage: 3:290/300 of query aligns to 1:289/292 of P0A7B3
- R175 (= R177) mutation to E: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to G: Exhibits NADH kinase activity in addition to NAD kinase activity. Reduces the Vmax of the NAD kinase activity.; mutation to H: Exhibits NADH kinase activity in addition to NAD kinase activity.; mutation to I: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to K: Does not exhibit NADH kinase activity in addition to NAD kinase activity.; mutation to Q: Exhibits NADH kinase activity in addition to NAD kinase activity.; mutation to T: Exhibits NADH kinase activity in addition to NAD kinase activity.
7mh7A Crystal structure of NAD kinase from pseudomonas aeruginosa pao1
37% identity, 94% coverage: 7:288/300 of query aligns to 3:286/290 of 7mh7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D71 (= D75), G72 (= G76), R93 (≠ H97), F98 (= F102), N145 (= N149), D146 (= D150), T186 (= T190), A187 (= A191), Y188 (= Y192), S191 (= S195), D244 (= D246), K283 (= K285)
P9WHV7 NAD kinase; ATP-dependent NAD kinase; Poly(P)-dependent NAD kinase; PPNK; EC 2.7.1.23 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
32% identity, 68% coverage: 66:268/300 of query aligns to 76:279/307 of P9WHV7
- D85 (= D75) mutation to A: Abolishes catalytic activity.
- N159 (= N149) mutation to A: Abolishes catalytic activity.
- NE 159:160 (≠ ND 149:150) binding
- E160 (≠ D150) mutation to A: Abolishes catalytic activity.
- G190 (= G180) mutation to A: Abolishes catalytic activity.
- L192 (≠ I182) mutation to A: Abolishes catalytic activity.
- T195 (= T185) mutation to A: It promotes stronger allosteric interactions.
- P196 (= P186) mutation to A: Abolishes catalytic activity.
- T197 (= T187) binding ; mutation to A: Abolishes catalytic activity.
- G198 (= G188) mutation to A: Abolishes catalytic activity.
- S199 (= S189) mutation to A: Lower catalytic efficiency. A perturbation of the allosteric interactions is observed when NAD is used as substrate.
- T200 (= T190) mutation to A: Abolishes catalytic activity.
- TAYAFS 200:205 (≠ TAYALS 190:195) binding
- Y202 (= Y192) mutation to A: Abolishes catalytic activity.
- G207 (≠ Q197) mutation to A: Abolishes catalytic activity.
- G208 (= G198) mutation to A: Possesses 30% of the activity compared to the wild-type enzyme. While mutant affects the catalytic efficiency, it does not alter the binding affinity for ATP and poly(P). It causes a decrease in the affinity for NAD and alters the allosteric interactions mediated by the dinucleotide, both in the presence of poly(P) and ATP.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
O13863 Uncharacterized kinase C1B1.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 86% coverage: 34:290/300 of query aligns to 238:513/537 of O13863
Sites not aligning to the query:
- 72 modified: Phosphoserine
1y3iA Crystal structure of mycobacterium tuberculosis NAD kinase-NAD complex (see paper)
32% identity, 65% coverage: 73:268/300 of query aligns to 12:208/231 of 1y3iA
- binding nicotinamide-adenine-dinucleotide: D14 (= D75), G15 (= G76), R38 (= R99), F41 (= F102), L42 (≠ I103), N88 (= N149), E89 (≠ D150), T129 (= T190), A130 (= A191), Y131 (= Y192), S134 (= S195)
3afoA Crystal structure of yeast nadh kinase complexed with nadh
28% identity, 85% coverage: 7:261/300 of query aligns to 37:315/360 of 3afoA
- binding 1,4-dihydronicotinamide adenine dinucleotide: D120 (= D75), G121 (= G76), L124 (= L79), F148 (= F102), N196 (= N149), D197 (= D150), T237 (= T190), A238 (= A191), Y239 (= Y192), S242 (= S195), D300 (= D246), G301 (≠ M247)
Q9P7K3 Uncharacterized kinase C24B10.02c; EC 2.7.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 74% coverage: 67:289/300 of query aligns to 176:407/449 of Q9P7K3
Sites not aligning to the query:
- 420 modified: Phosphoserine
1z0zA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with NAD (see paper)
32% identity, 63% coverage: 58:246/300 of query aligns to 32:217/249 of 1z0zA
- active site: E96 (≠ N122), C105 (≠ L131)
- binding nicotinamide-adenine-dinucleotide: N115 (= N149), E116 (≠ D150), M127 (= M161), R143 (= R177), D145 (= D179), T156 (= T190), Y158 (= Y192), S161 (= S195), F182 (≠ H216), D209 (≠ G238), G210 (≠ R239)
1z0sA Crystal structure of an NAD kinase from archaeoglobus fulgidus in complex with atp (see paper)
32% identity, 63% coverage: 58:246/300 of query aligns to 32:217/249 of 1z0sA
- active site: E96 (≠ N122), C105 (≠ L131)
- binding adenosine-5'-triphosphate: R54 (≠ G80), N115 (= N149), E116 (≠ D150), A125 (≠ S159), K126 (≠ G160), M127 (= M161), D145 (= D179), G157 (≠ A191), Y158 (= Y192), S161 (= S195), A180 (= A214), F182 (≠ H216), D209 (≠ G238)
- binding pyrophosphate 2-: G48 (= G74), G50 (= G76), T51 (= T77), R54 (≠ G80), R72 (= R99)
Sites not aligning to the query:
1suwA Crystal structure of a NAD kinase from archaeoglobus fulgidus in complex with its substrate and product: insights into the catalysis of NAD kinase (see paper)
32% identity, 63% coverage: 58:246/300 of query aligns to 32:217/249 of 1suwA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G48 (= G74), D49 (= D75), G50 (= G76), N115 (= N149), E116 (≠ D150), A125 (≠ S159), M127 (= M161), R143 (= R177), D145 (= D179), T156 (= T190), Y158 (= Y192), S161 (= S195), F182 (≠ H216), D209 (≠ G238), G210 (≠ R239)
O30297 NAD kinase; ATP-dependent NAD kinase; EC 2.7.1.23 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
32% identity, 63% coverage: 58:246/300 of query aligns to 32:217/249 of O30297
6rc0A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
29% identity, 61% coverage: 67:249/300 of query aligns to 37:222/261 of 6rc0A
3v8nA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with 8-bromo-5'-amino-5'-deoxyadenosine, reacted with a citrate molecule in n site (see paper)
30% identity, 66% coverage: 53:249/300 of query aligns to 30:218/257 of 3v8nA
5ejiA Crystal structure of NAD kinase w78f mutant from listeria monocytogenes in complex with NADP/mn++/ppi
30% identity, 61% coverage: 67:249/300 of query aligns to 37:221/260 of 5ejiA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G44 (= G74), D45 (= D75), L72 (= L100), G73 (= G101), F74 (= F102), Y75 (≠ I103), N118 (= N149), E119 (≠ D150), T157 (= T190), A158 (= A191), Y159 (= Y192), S162 (= S195)
- binding pyrophosphate 2-: G44 (= G74), D45 (= D75), G46 (= G76), T47 (= T77)
6rc1A Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
30% identity, 61% coverage: 67:249/300 of query aligns to 37:221/259 of 6rc1A
6rbpA Crystal structure of NAD kinase 1 from listeria monocytogenes in complexe with an adenine derivative (see paper)
30% identity, 61% coverage: 67:249/300 of query aligns to 37:221/260 of 6rbpA
8a9vA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
29% identity, 61% coverage: 67:249/300 of query aligns to 37:222/261 of 8a9vA
- binding ~{N}-[[(2~{R},3~{S},4~{R},5~{R})-5-[8-[3-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy]prop-1-ynyl]-6-azanyl-purin-9-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-2-azanyl-ethanesulfonamide: D45 (= D75), L49 (= L79), L72 (= L100), F74 (= F102), Y75 (≠ I103), N119 (= N149), E120 (≠ D150), T158 (= T190), A159 (= A191), Y160 (= Y192), S163 (= S195), H220 (≠ M247)
7zzjA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
29% identity, 61% coverage: 67:249/300 of query aligns to 37:222/261 of 7zzjA
- binding (1~{R},23~{R},24~{S},25~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-24,25-bis(oxidanyl)-26-oxa-2,4,6,9,14,17,21-heptazatetracyclo[21.2.1.0^{2,10}.0^{3,8}]hexacosa-3(8),4,6,9-tetraen-11-yne-16,20-dione: D45 (= D75), G46 (= G76), L72 (= L100), F74 (= F102), Y75 (≠ I103), N119 (= N149), E120 (≠ D150), T158 (= T190), A159 (= A191), Y160 (= Y192), S163 (= S195), H220 (≠ M247)
7zzgA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
29% identity, 61% coverage: 67:249/300 of query aligns to 37:222/261 of 7zzgA
- binding (1~{R},24~{R},25~{S},26~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-25,26-bis(oxidanyl)-27-oxa-2,4,6,9,14,17,20,22-octazatetracyclo[22.2.1.0^{2,10}.0^{3,8}]heptacosa-3(8),4,6,9-tetraen-11-yne-16,21-dione: D45 (= D75), G46 (= G76), F74 (= F102), Y75 (≠ I103), N119 (= N149), E120 (≠ D150), T158 (= T190), A159 (= A191), Y160 (= Y192), S163 (= S195), H220 (≠ M247)
7zzeA Crystal structure of NAD kinase 1 from listeria monocytogenes in complex with a linear di-adenosine derivative (see paper)
29% identity, 61% coverage: 67:249/300 of query aligns to 37:222/261 of 7zzeA
- binding (1~{R},25~{R},26~{S},27~{R})-14-[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl]-7-azanyl-26,27-bis(oxidanyl)-28-oxa-2,4,6,9,14,17,21,23-octazatetracyclo[23.2.1.0^{2,10}.0^{3,8}]octacosa-3(8),4,6,9-tetraen-11-yne-16,22-dione: D45 (= D75), G46 (= G76), F74 (= F102), Y75 (≠ I103), N119 (= N149), E120 (≠ D150), S155 (≠ T187), T158 (= T190), A159 (= A191), Y160 (= Y192), S163 (= S195), H220 (≠ M247)
Query Sequence
>H281DRAFT_04693 FitnessBrowser__Burk376:H281DRAFT_04693
MQVTSQFKTVALVGRNNTPGIREPLTALASCIAKRGFEVFFEADTAAEIGVTEYPALRPA
EIGARADVAIVLGGDGTMLGIGRQLAPYRTPLIGINHGRLGFITDIPISDMSEIVPQMLA
GNFEREERVLLEARIMRQGNPIYHALAFNDVVVNRSGFSGMAELHVSVDGRFMYNQRSDG
LIVATPTGSTAYALSSQGPILHPQLQGIVLVPIAPHALSNRPIVLPDDSKVSIQIVSGRE
VNVNFDMQSFTSLELGDAIEVRRSRHTVPMLHPVGYSYFATLRKKLHWNEYPSHEEDGKL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory