Comparing H281DRAFT_04917 FitnessBrowser__Burk376:H281DRAFT_04917 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
8sc2A Human oct1 bound to diltiazem in inward-open conformation (see paper)
24% identity, 91% coverage: 2:396/433 of query aligns to 79:423/453 of 8sc2A
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
27% identity, 47% coverage: 36:239/433 of query aligns to 56:234/444 of Q8NLB7
Sites not aligning to the query:
8sc6A Human oct1 bound to thiamine in inward-open conformation (see paper)
24% identity, 91% coverage: 2:396/433 of query aligns to 79:416/447 of 8sc6A
8et9A Cryo-em structure of the organic cation transporter 2 in complex with 1-methyl-4-phenylpyridinium (see paper)
31% identity, 41% coverage: 2:178/433 of query aligns to 96:254/517 of 8et9A
Sites not aligning to the query:
O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
29% identity, 36% coverage: 2:158/433 of query aligns to 98:234/556 of O08966
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 46% coverage: 68:267/433 of query aligns to 178:368/616 of P36035
Sites not aligning to the query:
>H281DRAFT_04917 FitnessBrowser__Burk376:H281DRAFT_04917
MQGTLSSNVPLSVDTLARQRRHAIIATVLGNGLEWFDFTVYSFFAVIIAKLFFPTGNDLT
SLLLAVATFGVGFFMRPVGGIVLGVYADKVGRKAALSLTILLMAGGTALIGIAPTYQQIG
LWAPVLIVIARLLQGFSAGGEMGSATAFLTEYAPANKRAYYSSWIQSSIGFAVLLGAAVG
TFVTSSLSTEALHSWGWRMPFLIGMLIGPVGYFIRSRMDETPAFSAVADEAKDDSPLAEV
FRRFPRETFASFSMVILWTVCTYVLLFYMPTYSVRTLHLPQSTGFLAGMFGGSMIMCFAP
VVGKLADRYGRRRFLSGAAVLILVLAWPMFAYINRAPGLASLMVFQGVFGLLIAAYTGPI
LAAFSELFPTKVLSTGLSVAYNFAVTIFGGFAPFFITWLIASTGSNMAPAFYVMIAAAIS
LTGTFFVRDPQRH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory