Comparing H281DRAFT_04927 FitnessBrowser__Burk376:H281DRAFT_04927 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
63% identity, 95% coverage: 14:272/272 of query aligns to 7:265/265 of P07821
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
35% identity, 83% coverage: 28:254/272 of query aligns to 9:231/231 of 1l7vC
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
35% identity, 83% coverage: 28:254/272 of query aligns to 9:231/248 of 4fi3C
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 83% coverage: 18:243/272 of query aligns to 1:229/343 of P30750
Sites not aligning to the query:
A0R6H8 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 85% coverage: 15:244/272 of query aligns to 605:831/860 of A0R6H8
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 83% coverage: 18:243/272 of query aligns to 2:230/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 83% coverage: 18:243/272 of query aligns to 2:230/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 83% coverage: 18:243/272 of query aligns to 2:230/344 of 6cvlD
P59852 Lactococcin-G-processing and transport ATP-binding protein LagD; EC 3.4.22.-; EC 7.-.-.- from Lactococcus lactis subsp. lactis (Streptococcus lactis) (see paper)
27% identity, 89% coverage: 4:246/272 of query aligns to 455:694/703 of P59852
Sites not aligning to the query:
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
31% identity, 94% coverage: 18:272/272 of query aligns to 4:245/278 of 8bmsA
1jj7A Crystal structure of thE C-terminal atpase domain of human tap1 (see paper)
30% identity, 86% coverage: 13:246/272 of query aligns to 6:242/251 of 1jj7A
O06967 Multidrug resistance ABC transporter ATP-binding/permease protein BmrA; EC 7.6.2.- from Bacillus subtilis (strain 168) (see 2 papers)
31% identity, 82% coverage: 20:243/272 of query aligns to 342:564/589 of O06967
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
30% identity, 88% coverage: 20:259/272 of query aligns to 5:247/262 of 7chaI
7t55A Cryo-em structure of pcat1 in the inward-facing wide conformation under atp turnover condition (see paper)
28% identity, 83% coverage: 20:246/272 of query aligns to 480:704/715 of 7t55A
Sites not aligning to the query:
3vx4D Crystal structure of the nucleotide-binding domain of s. Mutans coma, a bifunctional atp-binding cassette transporter involved in the quorum-sensing pathway (see paper)
27% identity, 83% coverage: 21:246/272 of query aligns to 10:232/240 of 3vx4D
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 76% coverage: 37:244/272 of query aligns to 23:224/393 of P9WQI3
Q96J66 ATP-binding cassette sub-family C member 11; Multidrug resistance-associated protein 8; EC 7.6.2.2; EC 7.6.2.3 from Homo sapiens (Human) (see 5 papers)
31% identity, 78% coverage: 34:246/272 of query aligns to 527:723/1382 of Q96J66
Sites not aligning to the query:
Q03518 Antigen peptide transporter 1; APT1; ATP-binding cassette sub-family B member 2; Peptide supply factor 1; Peptide transporter PSF1; PSF-1; Peptide transporter TAP1; Peptide transporter involved in antigen processing 1; Really interesting new gene 4 protein; RING4; EC 7.4.2.14 from Homo sapiens (Human) (see 10 papers)
30% identity, 86% coverage: 13:246/272 of query aligns to 497:733/748 of Q03518
Sites not aligning to the query:
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
33% identity, 83% coverage: 18:243/272 of query aligns to 5:228/278 of 8bmpA
5d3mA Folate ecf transporter: amppnp bound state (see paper)
32% identity, 83% coverage: 18:243/272 of query aligns to 5:231/280 of 5d3mA
>H281DRAFT_04927 FitnessBrowser__Burk376:H281DRAFT_04927
MNANLTVDSARAVHGEPMYELDDVSFRIGERVLLHPLALTLPRGRVCGLIGHNGSGKSTL
LKLLARQQSPKAGTLRFAGRPLREWENREFARQVAYLPQQQPAASGMTVRELVALGRYPW
HGALGRFTGVDAEKVHEAMELTDITRFGDRAVDSLSGGERQRAWIAMLVAQDSQCLLLDE
PISALDIAHQIEVLDLVRTLSQQRGLGVVVVLHDINMAARFCDDLIALKNGRLLASGTAP
ELIEEKMLGAIYGVPMGTVAHPRGGMPISFAY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory