Comparing H281DRAFT_04951 H281DRAFT_04951 cation/acetate symporter to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q92911 Sodium/iodide cotransporter; Na(+)/I(-) cotransporter; Natrium iodide transporter; Sodium-iodide symporter; Na(+)/I(-) symporter; Solute carrier family 5 member 5 from Homo sapiens (Human) (see 3 papers)
28% identity, 23% coverage: 64:220/672 of query aligns to 46:201/643 of Q92911
Sites not aligning to the query:
P07117 Sodium/proline symporter; Proline carrier; Proline permease; Propionate transporter from Escherichia coli (strain K12) (see 4 papers)
26% identity, 29% coverage: 59:253/672 of query aligns to 29:231/502 of P07117
Sites not aligning to the query:
3dh4A Crystal structure of sodium/sugar symporter with bound galactose from vibrio parahaemolyticus (see paper)
25% identity, 20% coverage: 487:620/672 of query aligns to 311:448/512 of 3dh4A
Sites not aligning to the query:
5nv9A Substrate-bound outward-open state of a na+-coupled sialic acid symporter reveals a novel na+-site (see paper)
29% identity, 29% coverage: 37:233/672 of query aligns to 4:202/480 of 5nv9A
Sites not aligning to the query:
Q9NY91 Probable glucose sensor protein SLC5A4; Solute carrier family 5 member 4 from Homo sapiens (Human) (see paper)
26% identity, 23% coverage: 65:218/672 of query aligns to 58:212/659 of Q9NY91
Sites not aligning to the query:
>H281DRAFT_04951 H281DRAFT_04951 cation/acetate symporter
MKLTNRLVRSYAFYTLGFLLFIYVMWRIERTTGPGMWIGYVFLFVPIAVYAVIGLLSRTS
DLVEYYVAGRRVPSAFNGMATAADWLSAASFIGLAGSIYATGYDGLAYLMGWTGGYCLVA
FLLAPYVRKLARYTIPDFLGTRFSSNAVRGLAALSAILCSFVYLVAQIQGVGLIATRFIG
VDFAVGIFCGLAGILVCSFLGGMRAVTWTQVAQYIILISAILIPVSMIAHKDGLGWVPQL
SYGRLMERMESLEKQVRDEPLEQTVRDDYRRRAALMQQRLDMLPHSFVAQKLKLTQEVAD
LRRRNGPLREIKEREKALEQFPRDAAAAQIVWSQQRDEMLMRAAAPLPMHEPFPAASDDD
RRMHERNFLSLLLCLSLGTASLPHILTRYNTTTSVASARRSVGWTLFFVALFYVTVPVLA
VLIKYEMLTNLVGHHFSDLPQWLTQWRKVEPSLITLADTNGDGIVRWSEIQMQPDMVVLA
APEIAGLPYVMSGLIAAGALAAALSTADGLLLTIANALSHDVYYHMVDPGASSQRRVTIS
KILLLGVALFASYVASLNTGNILFLVGAAFSLAASSLFPVLVLGVFWKRTTRLGAVAGML
AGLLVCIYYIVSTYPFFAQMTGFAGPRWFGIEPISSGVFGVPAGFLVAIGVSLFDRKPDA
YTTALVDYIRHP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory