Comparing H281DRAFT_05166 FitnessBrowser__Burk376:H281DRAFT_05166 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
35% identity, 89% coverage: 25:496/533 of query aligns to 5:474/501 of P04983
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 39% coverage: 25:234/533 of query aligns to 2:219/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 39% coverage: 25:234/533 of query aligns to 3:220/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 39% coverage: 25:234/533 of query aligns to 3:220/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 39% coverage: 25:234/533 of query aligns to 3:220/344 of 3tuiC
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 41% coverage: 25:242/533 of query aligns to 2:222/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 43% coverage: 23:250/533 of query aligns to 1:237/241 of 4u00A
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
32% identity, 41% coverage: 25:242/533 of query aligns to 3:222/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
32% identity, 41% coverage: 25:242/533 of query aligns to 3:222/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
32% identity, 41% coverage: 25:242/533 of query aligns to 3:222/238 of 6s8gA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
32% identity, 41% coverage: 25:242/533 of query aligns to 3:222/233 of 6b8bA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 44% coverage: 9:242/533 of query aligns to 2:234/378 of P69874
Sites not aligning to the query:
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 41% coverage: 25:242/533 of query aligns to 3:222/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 41% coverage: 25:242/533 of query aligns to 3:222/234 of 4p31A
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 41% coverage: 25:242/533 of query aligns to 4:223/241 of 6mbnA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 42% coverage: 28:249/533 of query aligns to 8:243/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 42% coverage: 28:249/533 of query aligns to 8:243/254 of 1g6hA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
31% identity, 43% coverage: 27:254/533 of query aligns to 9:241/375 of 2d62A
3d31A Modbc from methanosarcina acetivorans (see paper)
31% identity, 38% coverage: 41:242/533 of query aligns to 17:214/348 of 3d31A
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 40% coverage: 30:242/533 of query aligns to 9:224/242 of 3c4jA
>H281DRAFT_05166 FitnessBrowser__Burk376:H281DRAFT_05166
MSDSFYSDGAAAQPATRPEQAAPRLMLKGITKQYPAVRANDDVTLIVAPGEIHAVLGENG
AGKSTLMKVIYGAVRPDAGEIQWEGEAVDIASPAAARKLGIGMVFQHFSLFETLTVGENI
ALALDEPFDLKALSKRIREVSADYGLDIDPQRHVHSLTVGERQRVEIVRCLLQNPRLLIM
DEPTSVLTPQAVRKLFATLRRLAAEGCSILYISHKLDEIQELCDTATVMRGGRVTGHVKP
KEETHASLAQLMVGHSLPDYTRREHNPGAVLLDVKALSVTSDDPFGTSLENVSFAVHAGE
IFGIAGVSGNGQAELLSALSGEKRGLRADAVTICGKPAGRLGAGGRRALGFGFVPEERLG
RGAVPAMTLSENALLTAHRQKMVKSGWINSGAMRAFARRCIEAFDVRCGGSEALAQSLSG
GNLQKYIMGREILQAPKVLVVAQPTWGVDVGAAAFIRQQLLDLSASGVAILVISEELEEL
FDICDRIAVLAGGRLSPVRATGATNAEEIGRWMAGLFGGREGTAPSAEQPAHV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory