SitesBLAST
Comparing H281DRAFT_05211 FitnessBrowser__Burk376:H281DRAFT_05211 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
32% identity, 91% coverage: 8:307/329 of query aligns to 1:298/311 of 2varA
- active site: G254 (= G263), A255 (= A264), G256 (= G265), D257 (= D266)
- binding adenosine monophosphate: G227 (= G235), G230 (= G238), M259 (≠ F268), S284 (≠ G293), I288 (= I297)
- binding phosphoaminophosphonic acid-adenylate ester: K225 (= K233), G227 (= G235), S228 (≠ A236), G230 (= G238), G254 (= G263), A255 (= A264), G256 (= G265), D257 (= D266), M259 (≠ F268), I281 (≠ N290), S284 (≠ G293), I288 (= I297)
- binding 3-deoxy-alpha-D-erythro-hex-2-ulofuranosonic acid: L10 (≠ M17), G33 (= G40), S34 (≠ A41), Y89 (≠ F95), Y105 (= Y111), R107 (= R113), I136 (≠ V142), R165 (= R175), G254 (= G263), D257 (= D266)
- binding 2-keto-3-deoxygluconate: G33 (= G40), S34 (≠ A41), Y89 (≠ F95), L103 (≠ V109), Y105 (= Y111), R107 (= R113), I136 (≠ V142), R165 (= R175), T253 (≠ V262), G254 (= G263), D257 (= D266), D293 (= D302)
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
32% identity, 91% coverage: 8:307/329 of query aligns to 2:299/313 of Q97U29
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
33% identity, 95% coverage: 8:318/329 of query aligns to 2:303/309 of Q53W83
- GAEVN 34:38 (≠ GADLN 40:44) binding
- YYR 103:105 (≠ YFR 111:113) binding
- R167 (= R175) binding
- S193 (vs. gap) binding
- 219:225 (vs. 233:239, 71% identical) binding
- GAGD 248:251 (= GAGD 263:266) binding
- D251 (= D266) binding
- N275 (= N290) binding
- D287 (= D302) binding
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
33% identity, 94% coverage: 8:315/329 of query aligns to 2:300/300 of 1v1bA
- active site: G248 (= G263), A249 (= A264), G250 (= G265), D251 (= D266)
- binding adenosine-5'-triphosphate: K219 (= K233), G221 (= G235), A238 (≠ P254), F239 (≠ V255), V241 (vs. gap), G248 (= G263), A249 (= A264), G250 (= G265), N275 (= N290), A279 (= A294)
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
33% identity, 94% coverage: 8:315/329 of query aligns to 2:300/301 of 1v1aA
- active site: G248 (= G263), A249 (= A264), G250 (= G265), D251 (= D266)
- binding adenosine-5'-diphosphate: K219 (= K233), G221 (= G235), A222 (= A236), A249 (= A264), G250 (= G265), N275 (= N290), A279 (= A294)
- binding 2-keto-3-deoxygluconate: L11 (≠ M17), G34 (= G40), A35 (= A41), N38 (= N44), Y89 (≠ Q96), R105 (= R113), R167 (= R175), G248 (= G263), D251 (= D266), D287 (= D302)
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
30% identity, 94% coverage: 10:317/329 of query aligns to 3:306/308 of 2dcnA
- active site: G252 (= G263), A253 (= A264), G254 (= G265), D255 (= D266)
- binding adenosine-5'-diphosphate: D193 (≠ G202), K223 (= K233), G225 (= G235), P226 (≠ A236), G228 (= G238), V247 (= V258), G254 (= G265), I279 (≠ N290), S282 (≠ G293), V286 (≠ I297)
- binding 6-O-phosphono-beta-D-psicofuranosonic acid: G33 (= G40), F89 (= F95), Y105 (= Y111), R107 (= R113), I136 (≠ V142), R165 (= R175), T251 (≠ V262), G252 (= G263), D255 (= D266), D291 (= D302)
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
31% identity, 86% coverage: 33:315/329 of query aligns to 21:304/306 of 5eynA
- active site: G246 (= G263), A247 (= A264), G248 (= G265), D249 (= D266)
- binding adenosine-5'-diphosphate: H91 (≠ D103), T217 (≠ K233), G219 (= G235), A220 (= A236), A238 (≠ P254), V239 (= V255), T244 (= T261), G246 (= G263), A247 (= A264), G248 (= G265), F251 (= F268), N279 (= N290), G282 (= G293), A283 (= A294)
- binding beryllium trifluoride ion: G246 (= G263), G248 (= G265), D249 (= D266)
- binding beta-D-fructofuranose: G28 (= G40), A29 (= A41), N32 (= N44), F96 (≠ V109), F98 (≠ Y111), R159 (= R175), D249 (= D266)
Sites not aligning to the query:
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
27% identity, 92% coverage: 8:309/329 of query aligns to 2:301/312 of 3in1A
- active site: R106 (≠ D106), G255 (= G263), A256 (= A264), G257 (= G265), D258 (= D266)
- binding adenosine-5'-diphosphate: N194 (≠ G202), K225 (= K233), G227 (= G235), G230 (= G238), A244 (≠ G252), T253 (= T261), N282 (= N290), A285 (≠ G293)
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
31% identity, 86% coverage: 33:315/329 of query aligns to 25:308/310 of 5yggA
- binding adenosine-5'-diphosphate: K188 (≠ L200), T221 (≠ K233), G223 (= G235), A242 (≠ P254), V243 (= V255), F255 (= F268), N283 (= N290), G286 (= G293), A287 (= A294)
- binding beta-D-fructofuranose: G32 (= G40), A33 (= A41), F100 (≠ V109), F102 (≠ Y111), R163 (= R175), D253 (= D266)
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
32% identity, 82% coverage: 10:279/329 of query aligns to 3:255/304 of 3ih0A
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
32% identity, 82% coverage: 10:279/329 of query aligns to 2:254/302 of 3gbuA
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
29% identity, 94% coverage: 10:317/329 of query aligns to 4:307/308 of 3iq0B
- active site: G252 (= G263), A253 (= A264), G254 (= G265), D255 (= D266)
- binding adenosine-5'-triphosphate: S192 (≠ G202), K223 (= K233), G225 (= G235), E247 (≠ K257), A253 (= A264), G254 (= G265), F257 (= F268), N279 (= N290), G282 (= G293)
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
31% identity, 84% coverage: 8:282/329 of query aligns to 15:282/306 of 4ebuA
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 90% coverage: 34:328/329 of query aligns to 25:315/319 of Q8ZKR2
- G31 (= G40) binding
- Y101 (≠ A117) binding
- R162 (= R175) binding
- A180 (= A193) binding
- A181 (= A194) binding
- A183 (= A196) binding
- G213 (= G226) binding
- D246 (= D260) binding
- T248 (≠ V262) binding
- D252 (= D266) binding
- A287 (= A296) binding
- A290 (≠ V299) binding
- G292 (= G301) binding
Sites not aligning to the query:
4eumA Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
31% identity, 84% coverage: 8:282/329 of query aligns to 15:278/294 of 4eumA
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
28% identity, 86% coverage: 34:315/329 of query aligns to 21:295/299 of 1tz3A
- active site: C24 (≠ R37), F88 (≠ G115), G238 (= G263), A239 (= A264), G240 (= G265), D241 (= D266)
- binding 5-aminoimidazole ribonucleoside: G27 (= G40), L83 (≠ E110), F88 (≠ G115), Y90 (≠ A117), R151 (= R175), M154 (≠ L178), D241 (= D266)
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
28% identity, 86% coverage: 34:315/329 of query aligns to 21:295/297 of 1tz6A
- active site: C24 (≠ R37), F88 (≠ G115), G238 (= G263), A239 (= A264), G240 (= G265), D241 (= D266)
- binding phosphomethylphosphonic acid adenylate ester: N149 (= N173), K176 (≠ L200), E181 (= E205), S209 (≠ K233), G211 (= G235), A212 (= A236), G214 (= G238), A239 (= A264), G240 (= G265), F243 (= F268), N270 (= N290), G273 (= G293), A274 (= A294)
- binding 5-aminoimidazole ribonucleoside: G27 (= G40), F88 (≠ G115), Y90 (≠ A117), R151 (= R175), M154 (≠ L178), D241 (= D266)
Sites not aligning to the query:
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
29% identity, 94% coverage: 10:318/329 of query aligns to 8:302/312 of 4wjmA
- active site: G252 (= G263), A253 (= A264), G254 (= G265), D255 (= D266)
- binding phosphoaminophosphonic acid-adenylate ester: T223 (≠ K233), G225 (= G235), A226 (= A236), G228 (= G238), G252 (= G263), A253 (= A264), G254 (= G265), V257 (≠ F268), V292 (= V308), A295 (≠ E311)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
27% identity, 84% coverage: 40:314/329 of query aligns to 39:300/306 of 4xckA
- active site: A249 (≠ G263), A250 (= A264), G251 (= G265), D252 (= D266)
- binding adenosine-5'-diphosphate: T220 (≠ K233), G222 (= G235), S223 (≠ A236), V242 (≠ A256), T247 (= T261), A250 (= A264), F254 (= F268), H276 (≠ N290), A279 (≠ G293), V283 (≠ I297)
- binding alpha-D-ribofuranose: G39 (= G40), K40 (≠ A41), N43 (= N44), A95 (≠ Q96), I107 (≠ Y111), I109 (≠ R113), E140 (≠ V142), T248 (≠ V262), D252 (= D266)
Sites not aligning to the query:
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
28% identity, 86% coverage: 33:314/329 of query aligns to 32:300/305 of 1rk2A
- active site: A249 (≠ G263), A250 (= A264), G251 (= G265), D252 (= D266)
- binding adenosine-5'-diphosphate: T220 (≠ K233), G222 (= G235), S223 (≠ A236), A250 (= A264), G251 (= G265), H276 (≠ N290), A279 (≠ G293)
- binding tetrafluoroaluminate ion: G213 (= G226), R215 (= R228)
- binding magnesium ion: D246 (= D260), A282 (= A296), R285 (≠ V299), S291 (≠ G305)
- binding alpha-D-ribofuranose: G38 (≠ A39), G39 (= G40), K40 (≠ A41), N43 (= N44), E140 (≠ V142), D252 (= D266)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_05211 FitnessBrowser__Burk376:H281DRAFT_05211
MSNTSAALDIITYGEAMAMFVATETGPLASVGHFTKRIAGADLNVAIGLARLGFKVGWMS
RVGNDSFGQYVRDTLTKEGIDQRCVSTDERYPTGFQLKSKNDDGSDPAVEYFRRGSAASH
LSVADYVADYVLPARHLHLTGVAPAISASSRELAFHLAREMRAAGKTISFDPNLRPTLWP
SRAAMVEGLNALAALADWVLPGIGEGEILTGYTKPDDIAKFYLEQGARGVVVKLGAEGAY
FRTADDAGVIAGQPVAKVVDTVGAGDGFAVGVISALLEGRTLPQAVARGNRIGALAIQVI
GDSEGLPVRAELDAIERADLSNASLTRAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory