Comparing H281DRAFT_05221 FitnessBrowser__Burk376:H281DRAFT_05221 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
3abiA Crystal structure of l-lysine dehydrogenase from hyperthermophilic archaeon pyrococcus horikoshii (see paper)
32% identity, 67% coverage: 1:246/368 of query aligns to 2:240/349 of 3abiA
Sites not aligning to the query:
2zcvA Crystal structure of NADPH-dependent quinone oxidoreductase qor2 complexed with NADPH from escherichia coli (see paper)
33% identity, 29% coverage: 3:110/368 of query aligns to 2:117/283 of 2zcvA
Sites not aligning to the query:
P39315 Quinone oxidoreductase 2; EC 1.6.5.2 from Escherichia coli (strain K12) (see paper)
33% identity, 29% coverage: 3:110/368 of query aligns to 2:117/286 of P39315
Sites not aligning to the query:
5l78A Crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain (in NAD+ bound form)
23% identity, 50% coverage: 2:185/368 of query aligns to 2:193/436 of 5l78A
Sites not aligning to the query:
Q9UDR5 Alpha-aminoadipic semialdehyde synthase, mitochondrial; LKR/SDH; EC 1.5.1.8; EC 1.5.1.9 from Homo sapiens (Human)
23% identity, 50% coverage: 2:184/368 of query aligns to 482:672/926 of Q9UDR5
>H281DRAFT_05221 FitnessBrowser__Burk376:H281DRAFT_05221
MKVAIVGAGLIGHTIAHMLRETGDYDVVAFDRDQHALDKLAAQGISTRRVDSADAAALRA
AVHGFDALINALPYYLAVNVAAAAKGAGVHYFDLTEDVRATHAIRAIADDADHAFMPQCG
LAPGFIGIAAHELANRFTEIRDVKMRVGALPQFPTNALKYNLTWSVDGLINEYCQPCEAI
RDSRTQWVQPLEGLEHFSLDGTEYEAFNTSGGLGTLCETLSGRVESLDYKSVRYPGHRNL
MQFLLEDLRLSSDRDTLKTIMRRSVPSTAQDVVLVFITVSGMRDGQLVQEVFTRKIFAKT
ICGVPMSAIQITTAGAMCAVLDLFREKKLPQRGFVRQEQVSLRDFLGNRFGQLYEGQALE
SLQSAATV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory