SitesBLAST
Comparing H281DRAFT_05229 FitnessBrowser__Burk376:H281DRAFT_05229 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cqxA Ribokinase from t.Sp mutant a92g
47% identity, 97% coverage: 10:306/307 of query aligns to 2:295/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (= N190), T217 (= T226), G219 (= G228), A220 (≠ P229), G222 (= G231), F250 (= F261), N272 (≠ Q283), G275 (≠ A286), A276 (= A287), T279 (≠ V290)
- binding magnesium ion: D242 (= D253), T244 (= T255), A278 (≠ S289), S287 (= S298)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
44% identity, 97% coverage: 9:306/307 of query aligns to 3:299/306 of 4xckA
- active site: A249 (= A256), A250 (= A257), G251 (= G258), D252 (= D259)
- binding adenosine-5'-diphosphate: T220 (= T226), G222 (= G228), S223 (≠ P229), V242 (= V249), T247 (= T254), A250 (= A257), F254 (= F261), H276 (≠ Q283), A279 (= A286), V283 (= V290)
- binding alpha-D-ribofuranose: N11 (= N17), D13 (= D19), G39 (= G45), K40 (= K46), N43 (= N49), A95 (= A100), I107 (= I112), I109 (= I114), E140 (= E145), T248 (= T255), D252 (= D259)
6a8cA Ribokinase from leishmania donovani with adp (see paper)
39% identity, 96% coverage: 10:305/307 of query aligns to 16:322/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G228), A246 (≠ P229), T271 (= T254), A274 (= A257), G275 (= G258), N300 (≠ Q283), A303 (= A286)
- binding glycerol: D25 (= D19), S42 (≠ G36), S44 (≠ T38), G50 (= G44), G51 (= G45), N55 (= N49)
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
39% identity, 96% coverage: 10:305/307 of query aligns to 16:322/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G228), A246 (≠ P229), T271 (= T254), A274 (= A257), G275 (= G258), N300 (≠ Q283), A303 (= A286), V307 (= V290)
- binding glycerol: D25 (= D19), G50 (= G44), G51 (= G45), N55 (= N49), N157 (≠ L144), I159 (≠ T146), E190 (= E179)
6a8aA Ribokinase from leishmania donovani with atp (see paper)
39% identity, 96% coverage: 10:305/307 of query aligns to 16:322/327 of 6a8aA
- binding adenosine-5'-triphosphate: N207 (= N190), T243 (= T226), G245 (= G228), A246 (≠ P229), G248 (= G231), T271 (= T254), G273 (≠ A256), A274 (= A257), G275 (= G258), N300 (≠ Q283), A303 (= A286), V307 (= V290)
- binding glycerol: D25 (= D19), G50 (= G44), G51 (= G45), N55 (= N49)
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
44% identity, 96% coverage: 10:304/307 of query aligns to 7:299/309 of P0A9J6
1gqtB Activation of ribokinase by monovalent cations (see paper)
44% identity, 96% coverage: 10:304/307 of query aligns to 6:298/307 of 1gqtB
- active site: A251 (= A256), A252 (= A257), G253 (= G258), D254 (= D259)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N190), T222 (= T226), G224 (= G228), S225 (≠ P229), A252 (= A257), G253 (= G258), H278 (≠ Q283), A281 (= A286)
- binding cesium ion: D248 (= D253), I250 (≠ T255), A284 (≠ S289), R287 (= R292), S293 (= S298)
- binding alpha-D-ribofuranose: N13 (= N17), D15 (= D19), G41 (= G45), N45 (= N49), E142 (= E145), D254 (= D259)
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
44% identity, 96% coverage: 10:304/307 of query aligns to 4:296/305 of 1rk2A
- active site: A249 (= A256), A250 (= A257), G251 (= G258), D252 (= D259)
- binding adenosine-5'-diphosphate: T220 (= T226), G222 (= G228), S223 (≠ P229), A250 (= A257), G251 (= G258), H276 (≠ Q283), A279 (= A286)
- binding tetrafluoroaluminate ion: G213 (= G219), R215 (= R221)
- binding magnesium ion: D246 (= D253), A282 (≠ S289), R285 (= R292), S291 (= S298)
- binding alpha-D-ribofuranose: N11 (= N17), D13 (= D19), G38 (= G44), G39 (= G45), K40 (= K46), N43 (= N49), E140 (= E145), D252 (= D259)
6wjzA Crystal structure of human ribokinase in complex with ampcp
42% identity, 97% coverage: 8:305/307 of query aligns to 3:304/315 of 6wjzA
- binding phosphomethylphosphonic acid adenosyl ester: N186 (= N190), T222 (= T226), G224 (= G228), A225 (≠ P229), G227 (= G231), T243 (vs. gap), V246 (= V249), A254 (= A257), G255 (= G258), N282 (≠ Q283), A285 (= A286), A286 (= A287), V289 (= V290)
5c3yA Structure of human ribokinase crystallized with amppnp
42% identity, 97% coverage: 8:305/307 of query aligns to 2:303/306 of 5c3yA
- active site: G252 (≠ A256), A253 (= A257), G254 (= G258), D255 (= D259)
- binding amp phosphoramidate: T221 (= T226), G223 (= G228), V245 (= V249), T250 (= T254), G254 (= G258), N281 (≠ Q283), A284 (= A286), A285 (= A287)
2fv7A Crystal structure of human ribokinase
42% identity, 97% coverage: 8:305/307 of query aligns to 2:303/308 of 2fv7A
- active site: G252 (≠ A256), A253 (= A257), G254 (= G258), D255 (= D259)
- binding adenosine-5'-diphosphate: N185 (= N190), T221 (= T226), G223 (= G228), G226 (= G231), T242 (vs. gap), V245 (= V249), A253 (= A257), G254 (= G258), N281 (≠ Q283), A284 (= A286), A285 (= A287), V288 (= V290)
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
42% identity, 97% coverage: 8:305/307 of query aligns to 3:304/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N190), T222 (= T226), G224 (= G228), A225 (≠ P229), G227 (= G231), T243 (vs. gap), V246 (= V249), A254 (= A257), G255 (= G258), N282 (≠ Q283), A285 (= A286), A286 (= A287), V289 (= V290)
- binding alpha-D-ribofuranose: D14 (= D19), G40 (= G45), K41 (= K46), N44 (= N49), A96 (= A100), E141 (= E145), D256 (= D259)
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
42% identity, 97% coverage: 8:305/307 of query aligns to 3:304/317 of 5c41A
- active site: G253 (≠ A256), A254 (= A257), G255 (= G258), D256 (= D259)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N190), T222 (= T226), G224 (= G228), A225 (≠ P229), G227 (= G231), V246 (= V249), G255 (= G258), N282 (≠ Q283), A285 (= A286), A286 (= A287)
5byfA Crystal structure of human ribokinase in complex with amp
41% identity, 95% coverage: 14:305/307 of query aligns to 10:305/313 of 5byfA
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
42% identity, 93% coverage: 14:300/307 of query aligns to 22:312/322 of Q9H477
6znxC Ribokinase from thermus species
43% identity, 97% coverage: 10:306/307 of query aligns to 2:260/265 of 6znxC
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 96% coverage: 10:305/307 of query aligns to 71:371/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
36% identity, 96% coverage: 10:305/307 of query aligns to 5:305/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N190), K225 (≠ T226), G227 (= G228), I246 (≠ A246), A248 (≠ K248), A257 (= A257), G258 (= G258), F261 (= F261), A286 (= A286), S287 (≠ A287)
- binding alpha-D-ribofuranose: N12 (= N17), D14 (= D19), G40 (= G45), K41 (= K46), N44 (= N49), E144 (= E145), D259 (= D259)
6xk2A Crystal structure of ribokinase from cryptococcus neoformans var. Grubii serotype a in complex with adp
32% identity, 98% coverage: 6:306/307 of query aligns to 2:317/320 of 6xk2A
3ikhA Crystal structure of ribokinase in complex with atp and glycerol in the active site from klebsiella pneumoniae
29% identity, 95% coverage: 9:300/307 of query aligns to 3:276/286 of 3ikhA
Query Sequence
>H281DRAFT_05229 FitnessBrowser__Burk376:H281DRAFT_05229
VSSNETRARVAVVGSLNMDLVARAPRLPHPGETLAGRTFAQVAGGKGGNQAVAAARLGAQ
VSMLGCVGADANGAQLRAGLEAEGIDCAAVETGREATGVALIVVDDASQNAIVIVAGSNG
EVTPETIARHEAVLAAADVVICQLETPLDTVQAALATARRLGKTVILNPAPATGPLPAEW
LPLIDYLIPNELEAATLTGLPVGSPEEAATAAAVLRAAGARNVLVTLGPRGVQAALEGAA
PALYDAPKVKAIDTTAAGDTFIGGFAAQLAQGASVDAAIRFAQRAAALSVTRAGAQPSIP
TWTEVEG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory