Comparing H281DRAFT_05236 FitnessBrowser__Burk376:H281DRAFT_05236 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
25% identity, 78% coverage: 43:380/434 of query aligns to 29:381/446 of A0A0H2VG78
Sites not aligning to the query:
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 33% coverage: 86:229/434 of query aligns to 93:221/580 of Q9C757
Sites not aligning to the query:
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 34% coverage: 84:230/434 of query aligns to 90:221/582 of O23492
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 48% coverage: 1:210/434 of query aligns to 12:213/444 of Q8NLB7
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 49% coverage: 18:231/434 of query aligns to 40:261/583 of Q9Y7Q9
Sites not aligning to the query:
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
30% identity, 33% coverage: 76:219/434 of query aligns to 117:273/587 of P25297
Sites not aligning to the query:
8fvzA Pipt y150a
23% identity, 81% coverage: 25:377/434 of query aligns to 9:371/433 of 8fvzA
>H281DRAFT_05236 FitnessBrowser__Burk376:H281DRAFT_05236
MTDLTDHSVASAHDTRRRIFAIVGASSGNLVEWFDFYVYSFCALYFAPAFFPSGNTTTQL
LNTAGVFAAGFLMRPIGGWFFGRLADKHGRRMAMMVSVFMMCGGSLVIAVLPTYAQIGAL
APALLLVARLFQGLSVGGEYGTSATYMSEVALKGRRGFFASFQYVTLIGGQLCALLVLVV
LQQTLSTAELKAWGWRVPFVIGAVAALIALYLRKSLDETTTAATRQRKEAGTLRGLWKHR
VAFMTVLGFTAGGSLIFYTFTTYMQKYLVNTAGMSAKTASNVMTAALFVYMVLQPAFGAL
SDRIGRRNSMLCFGLFATIGTVPLLHALKDVTSPYAAFALVVLALAIVSFYTSISGLIKA
EMFPPEVRALGVGLSYAVANAIFGGSAEYVALWLKSVGSESMFYWYVTLLCAIAGLVALR
MRDPSKEGYLRHEP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory