Comparing H281DRAFT_05270 FitnessBrowser__Burk376:H281DRAFT_05270 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
40% identity, 89% coverage: 32:513/539 of query aligns to 1:470/501 of P04983
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 53% coverage: 34:320/539 of query aligns to 16:302/378 of P69874
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 40% coverage: 34:248/539 of query aligns to 1:213/241 of 4u00A
5x40A Structure of a cbio dimer bound with amppcp (see paper)
31% identity, 42% coverage: 34:262/539 of query aligns to 3:231/280 of 5x40A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
31% identity, 39% coverage: 308:519/539 of query aligns to 14:217/240 of 6mjpA
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
31% identity, 39% coverage: 41:251/539 of query aligns to 7:217/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
31% identity, 39% coverage: 41:251/539 of query aligns to 7:217/219 of 8w6iD
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
31% identity, 39% coverage: 41:251/539 of query aligns to 7:217/218 of 8hd0A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 40% coverage: 35:247/539 of query aligns to 1:212/240 of 4ymuJ
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
32% identity, 40% coverage: 312:525/539 of query aligns to 22:224/240 of 1ji0A
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 38% coverage: 41:247/539 of query aligns to 9:214/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 38% coverage: 41:247/539 of query aligns to 9:214/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 38% coverage: 41:247/539 of query aligns to 9:214/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 38% coverage: 41:247/539 of query aligns to 9:214/242 of 2oljA
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
29% identity, 40% coverage: 33:248/539 of query aligns to 2:220/650 of 5ws4A
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 37% coverage: 50:248/539 of query aligns to 15:205/348 of 3d31A
Sites not aligning to the query:
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
26% identity, 40% coverage: 32:248/539 of query aligns to 1:213/285 of 4yerA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 43% coverage: 35:267/539 of query aligns to 4:250/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 43% coverage: 35:267/539 of query aligns to 4:250/254 of 1g6hA
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
33% identity, 36% coverage: 41:232/539 of query aligns to 8:199/220 of 8tzjA
>H281DRAFT_05270 FitnessBrowser__Burk376:H281DRAFT_05270
MTHPASEPNPPATRTTPSVAATVAVDGDVDPCEPILATTGVSKTFPGVKALQRVDFRLFP
GEVHTLMGQNGAGKSTLINVLTGVIAPDTGTIRLAGEVVAFASPQEAEAAGVRTLYQEVN
LCPNLSVAENIFAGRQPRRFGAIDWPDIKRRAQAALARLDISLDVTRSLDAYPIAVQQMV
AIARALSVDARVLILDEPTSSLDDSEVAQLFKILRHLKQSGIAILFVTHFIEQTYAISDR
ITVMRNGEREGEYLARNLSADQLVAKMVGHERMSERLREAAHEASAPGGTERGERAASAF
IELRGVGKRGTLQPIDLNVERGQILGLAGLLGSGRTETARLLFGADRADSGTMLVDGKPV
RLRSPHDAVRHGIAYCAEDRKKEGIVADLSIRENILLALQARRGWWRKISRQRARELADL
WIERLGIKASDAEQPIGLLSGGNQQKALLARWLATDPKLLILDEPTRGIDVAAKFDIMDR
LLALCANGLSILFISSEISEVLRVSHRVAVLRDRRKIAEVEGKASNEDNIYRLIAGSGE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory