SitesBLAST
Comparing H281DRAFT_05297 FitnessBrowser__Burk376:H281DRAFT_05297 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
55% identity, 87% coverage: 22:271/287 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
55% identity, 87% coverage: 22:271/287 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
55% identity, 87% coverage: 22:271/287 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
55% identity, 87% coverage: 22:271/287 of query aligns to 3:242/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
56% identity, 86% coverage: 22:267/287 of query aligns to 1:236/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (= F32), V16 (= V37), S36 (= S57), G37 (= G58), S38 (= S59), G39 (= G60), K40 (= K61), S41 (= S62), T42 (= T63), E162 (= E193), H194 (= H225)
- binding magnesium ion: S41 (= S62), E162 (= E193)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
55% identity, 87% coverage: 21:271/287 of query aligns to 1:240/241 of 4u00A
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
51% identity, 87% coverage: 23:273/287 of query aligns to 3:255/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
52% identity, 86% coverage: 23:268/287 of query aligns to 7:254/258 of P02915
- S41 (= S57) binding
- G42 (= G58) binding
- G44 (= G60) binding
- K45 (= K61) binding
- S46 (= S62) binding
- T47 (= T63) binding
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 87% coverage: 22:271/287 of query aligns to 1:245/343 of P30750
- 40:46 (vs. 57:63, 86% identical) binding
- E166 (= E193) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 87% coverage: 22:271/287 of query aligns to 2:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 87% coverage: 22:271/287 of query aligns to 2:246/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 87% coverage: 22:271/287 of query aligns to 2:246/344 of 6cvlD
- binding phosphothiophosphoric acid-adenylate ester: F12 (= F32), Q14 (≠ E34), I19 (≠ V35), S41 (= S57), G42 (= G58), A43 (≠ S59), G44 (= G60), K45 (= K61), S46 (= S62), T47 (= T63), N141 (≠ K167), S143 (= S169), Q146 (= Q172), H200 (= H225)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 83% coverage: 20:257/287 of query aligns to 15:238/378 of P69874
- C26 (≠ R31) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (= F32) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ V50) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ S59) mutation to T: Loss of ATPase activity and transport.
- L60 (= L65) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ I81) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V155) mutation to M: Loss of ATPase activity and transport.
- D172 (= D192) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
40% identity, 82% coverage: 23:256/287 of query aligns to 3:222/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
40% identity, 82% coverage: 23:256/287 of query aligns to 4:223/371 of P68187
- A85 (≠ N118) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ P140) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A148) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ M151) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E153) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ S158) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G171) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D192) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
40% identity, 82% coverage: 23:256/287 of query aligns to 3:222/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F32), S37 (= S57), G38 (= G58), C39 (≠ S59), G40 (= G60), K41 (= K61), S42 (= S62), T43 (= T63), Q81 (= Q115), R128 (≠ A163), A132 (≠ K167), S134 (= S169), G136 (= G171), Q137 (= Q172), E158 (= E193), H191 (= H225)
- binding magnesium ion: S42 (= S62), Q81 (= Q115)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
40% identity, 82% coverage: 23:256/287 of query aligns to 3:222/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F32), G38 (= G58), C39 (≠ S59), G40 (= G60), K41 (= K61), S42 (= S62), T43 (= T63), R128 (≠ A163), S134 (= S169), Q137 (= Q172)
- binding beryllium trifluoride ion: S37 (= S57), G38 (= G58), K41 (= K61), Q81 (= Q115), S134 (= S169), G136 (= G171), H191 (= H225)
- binding magnesium ion: S42 (= S62), Q81 (= Q115)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
40% identity, 82% coverage: 23:256/287 of query aligns to 3:222/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F32), V17 (= V37), G38 (= G58), C39 (≠ S59), G40 (= G60), K41 (= K61), S42 (= S62), T43 (= T63), R128 (≠ A163), A132 (≠ K167), S134 (= S169), Q137 (= Q172)
- binding tetrafluoroaluminate ion: S37 (= S57), G38 (= G58), K41 (= K61), Q81 (= Q115), S134 (= S169), G135 (= G170), G136 (= G171), E158 (= E193), H191 (= H225)
- binding magnesium ion: S42 (= S62), Q81 (= Q115)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
40% identity, 82% coverage: 23:256/287 of query aligns to 3:222/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F32), V17 (= V37), G38 (= G58), C39 (≠ S59), G40 (= G60), K41 (= K61), S42 (= S62), T43 (= T63), R128 (≠ A163), A132 (≠ K167), S134 (= S169), Q137 (= Q172)
- binding magnesium ion: S42 (= S62), Q81 (= Q115)
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
40% identity, 82% coverage: 23:256/287 of query aligns to 1:220/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F32), S35 (= S57), G36 (= G58), C37 (≠ S59), G38 (= G60), K39 (= K61), S40 (= S62), T41 (= T63), R126 (≠ A163), A130 (≠ K167), S132 (= S169), G134 (= G171), Q135 (= Q172)
Query Sequence
>H281DRAFT_05297 FitnessBrowser__Burk376:H281DRAFT_05297
MNAIADMPSSASAVHARHGSPLIQVRDLRKRFGEVEVLRGVDLEIARSEVVCIIGPSGSG
KSTLLRCLAALETYDHGDVRIEGELLGYSERNGKRVRATQGEINRVRRNVGMVFQQFNLW
PHMTALGNVMEALLRVRHLPHADARRRANAMLETVGLSNKGDAYPAKLSGGQQQRVAIAR
ALAMEPHIMLFDEPTSALDPELVGEVLQVMKQLARDGMTMAVVTHEMGFAAQVADKVMFI
DQGRIAVQGQPREVFHDAGQPRLRQFLQNYFDRNAFWARGPDDAEPL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory