SitesBLAST
Comparing H281DRAFT_05310 FitnessBrowser__Burk376:H281DRAFT_05310 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7CRQ0 Uronate dehydrogenase; D-galacturonate dehydrogenase; D-glucuronate dehydrogenase; Hexuronate dehydrogenase; EC 1.1.1.203 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
48% identity, 91% coverage: 1:256/280 of query aligns to 1:257/265 of Q7CRQ0
- Y134 (= Y135) mutation to A: 0.1% of wild-type activity.
3rfvA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens complexed with nadh and product (see paper)
48% identity, 91% coverage: 1:256/280 of query aligns to 2:258/265 of 3rfvA
- binding D-galactaro-1,5-lactone: S74 (= S74), S110 (= S110), N111 (= N111), H112 (= H112), Y135 (= Y135), S164 (= S164), R173 (= R173), F257 (= F255)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G8), G12 (= G11), Q13 (= Q12), L14 (= L13), D33 (≠ A32), L34 (≠ G33), D50 (= D50), L51 (= L51), L70 (≠ F70), G71 (≠ A71), G72 (= G72), S74 (= S74), A108 (= A108), S110 (= S110), Y135 (= Y135), K139 (= K139), I162 (= I162), S164 (= S164), C165 (= C165)
3rfxA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with NAD (see paper)
48% identity, 91% coverage: 1:256/280 of query aligns to 2:258/265 of 3rfxA
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
30% identity, 59% coverage: 47:212/280 of query aligns to 60:217/322 of 1r6dA
- active site: T127 (≠ S110), N128 (= N111), Q129 (≠ H112), Y151 (= Y135), K155 (= K139)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S74), H88 (vs. gap), T127 (≠ S110), N128 (= N111), Q129 (≠ H112), Y151 (= Y135), N180 (≠ E167), K190 (≠ H174), L191 (= L175), P206 (≠ T201), Y208 (≠ W203), R215 (= R210)
- binding nicotinamide-adenine-dinucleotide: D63 (= D50), I64 (≠ L51), F83 (= F70), A84 (= A71), A85 (≠ G72), S87 (= S74), T102 (≠ N85), V125 (≠ A108), S126 (= S109), Y151 (= Y135), K155 (= K139), N181 (≠ R168)
Sites not aligning to the query:
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: 250, 274, 277, 281
- binding nicotinamide-adenine-dinucleotide: 10, 11, 12, 37, 38, 39, 40, 42, 43
7cgvA Full consensus l-threonine 3-dehydrogenase, fctdh-iiym (NAD+ bound form) (see paper)
29% identity, 61% coverage: 2:172/280 of query aligns to 1:176/310 of 7cgvA
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Q11 (= Q12), I12 (≠ L13), D33 (≠ G33), I34 (≠ S34), R35 (≠ K35), L48 (≠ G49), D49 (= D50), V50 (≠ L51), A72 (= A71), A73 (≠ G72), L75 (vs. gap), P112 (≠ A108), S114 (= S110), Y139 (= Y135), K143 (= K139), Y166 (≠ I162), I169 (≠ C165)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
29% identity, 59% coverage: 47:212/280 of query aligns to 60:217/322 of 1r66A
- active site: T127 (≠ S110), D128 (≠ N111), E129 (≠ H112), Y151 (= Y135), K155 (= K139)
- binding nicotinamide-adenine-dinucleotide: D63 (= D50), I64 (≠ L51), F83 (= F70), A84 (= A71), A85 (≠ G72), S87 (= S74), T102 (≠ N85), V125 (≠ A108), S126 (= S109), Y151 (= Y135), K155 (= K139), N181 (≠ R168)
- binding thymidine-5'-diphosphate: H88 (vs. gap), E129 (≠ H112), N180 (≠ E167), K190 (≠ H174), L191 (= L175), P206 (≠ T201), Y208 (≠ W203), R215 (= R210)
Sites not aligning to the query:
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
29% identity, 57% coverage: 4:162/280 of query aligns to 2:159/321 of 4id9A
- active site: S106 (= S110), Y132 (= Y135), K136 (= K139)
- binding nicotinamide-adenine-dinucleotide: G9 (= G11), R10 (≠ Q12), V11 (≠ L13), D30 (≠ P36), L31 (= L37), R32 (≠ T38), S44 (≠ D50), L45 (= L51), L64 (≠ F70), A66 (≠ G72), V81 (≠ N85), S106 (= S110), Y132 (= Y135), K136 (= K139), F159 (≠ I162)
Sites not aligning to the query:
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
29% identity, 57% coverage: 4:162/280 of query aligns to 3:160/328 of 4id9B
- active site: S107 (= S110), Y133 (= Y135), K137 (= K139)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), R11 (≠ Q12), V12 (≠ L13), D31 (≠ P36), L32 (= L37), S45 (≠ D50), L46 (= L51), L65 (≠ F70), A67 (≠ G72), V82 (≠ N85), Y133 (= Y135), K137 (= K139), F160 (≠ I162)
Sites not aligning to the query:
6k0iA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glc (see paper)
34% identity, 35% coverage: 49:147/280 of query aligns to 57:161/335 of 6k0iA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: D58 (= D50), V59 (≠ L51), F80 (= F70), A81 (= A71), G82 (= G72), K84 (vs. gap), N99 (= N85), S122 (≠ A108), S123 (= S109), Y149 (= Y135), K153 (= K139)
- binding uridine-5'-diphosphate-glucose: K84 (vs. gap), S124 (= S110), Y149 (= Y135)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 7, 10, 11, 12, 31, 32, 35, 36, 177, 180
- binding uridine-5'-diphosphate-glucose: 178, 179, 198, 199, 200, 216, 217, 218, 231, 233, 268, 291, 294
6k0hA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glcnac (see paper)
34% identity, 35% coverage: 49:147/280 of query aligns to 57:161/335 of 6k0hA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: D58 (= D50), V59 (≠ L51), F80 (= F70), A81 (= A71), G82 (= G72), K84 (vs. gap), N99 (= N85), S123 (= S109), Y149 (= Y135), K153 (= K139)
- binding uridine-diphosphate-n-acetylglucosamine: K84 (vs. gap), S124 (= S110), Y149 (= Y135)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 7, 10, 11, 12, 31, 32, 34, 35, 36, 177, 180
- binding uridine-diphosphate-n-acetylglucosamine: 178, 179, 198, 199, 200, 216, 217, 218, 231, 233, 268, 291, 294
6k0gA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp (see paper)
34% identity, 35% coverage: 49:147/280 of query aligns to 57:161/335 of 6k0gA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding magnesium ion: E66 (≠ D58), H114 (= H100)
- binding nicotinamide-adenine-dinucleotide: D58 (= D50), V59 (≠ L51), F80 (= F70), A81 (= A71), G82 (= G72), K84 (vs. gap), N99 (= N85), S122 (≠ A108), S123 (= S109), Y149 (= Y135), K153 (= K139)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 7, 10, 11, 12, 31, 32, 35, 36, 177, 180
- binding uridine-5'-diphosphate: 179, 198, 199, 200, 216, 217, 218, 231, 233, 268, 291, 294
3a1nA Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
22% identity, 60% coverage: 4:172/280 of query aligns to 2:174/315 of 3a1nA
- active site: T112 (≠ S110), Y137 (= Y135), K141 (= K139)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ G10), G9 (= G11), Q10 (= Q12), I11 (≠ L13), D32 (≠ K35), I33 (≠ P36), L46 (≠ G49), D47 (= D50), L69 (≠ F70), A70 (= A71), G71 (= G72), L73 (≠ S74), S111 (= S109), Y137 (= Y135), K141 (= K139), Y164 (≠ I162)
3a4vA Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
22% identity, 60% coverage: 4:172/280 of query aligns to 2:174/311 of 3a4vA
- active site: T112 (≠ S110), Y137 (= Y135), K141 (= K139)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ G10), G9 (= G11), Q10 (= Q12), I11 (≠ L13), D32 (≠ K35), I33 (≠ P36), L46 (≠ G49), D47 (= D50), V48 (≠ L51), L69 (≠ F70), A70 (= A71), G71 (= G72), L73 (≠ S74), P110 (≠ A108), S111 (= S109), T112 (≠ S110), Y137 (= Y135), K141 (= K139), Y164 (≠ I162), I167 (≠ C165)
- binding pyruvic acid: S74 (≠ V75), Y137 (= Y135)
Sites not aligning to the query:
3a9wA Crystal structure of l-threonine bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
21% identity, 60% coverage: 4:172/280 of query aligns to 2:174/315 of 3a9wA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ G10), G9 (= G11), Q10 (= Q12), I11 (≠ L13), D32 (≠ K35), I33 (≠ P36), L46 (≠ G49), D47 (= D50), V48 (≠ L51), L69 (≠ F70), A70 (= A71), L73 (≠ S74), V87 (≠ N85), P110 (≠ A108), S111 (= S109), K141 (= K139), Y164 (≠ I162), I167 (≠ C165)
- binding threonine: S74 (≠ V75), T112 (≠ S110), F137 (≠ Y135)
Sites not aligning to the query:
3ajrA Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
21% identity, 60% coverage: 4:172/280 of query aligns to 2:174/314 of 3ajrA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ G10), G9 (= G11), Q10 (= Q12), I11 (≠ L13), D32 (≠ K35), I33 (≠ P36), L46 (≠ G49), D47 (= D50), V48 (≠ L51), L69 (≠ F70), A70 (= A71), G71 (= G72), L73 (≠ S74), P110 (≠ A108), S111 (= S109), T112 (≠ S110), F137 (≠ Y135), K141 (= K139), Y164 (≠ I162), I167 (≠ C165)
- binding (3R)-3-hydroxy-L-norvaline: S74 (≠ V75), T112 (≠ S110), I113 (≠ N111), F137 (≠ Y135)
Sites not aligning to the query:
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
27% identity, 51% coverage: 3:145/280 of query aligns to 2:159/338 of 2udpA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), L33 (≠ A31), C34 (≠ A32), N35 (≠ G33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (= F70), A81 (= A71), G82 (= G72), K84 (vs. gap), S122 (≠ A108), S124 (= S110), Y149 (= Y135), K153 (= K139)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177
- binding phenyl-uridine-5'-diphosphate: 179, 199, 200, 216, 217, 218, 231, 233, 269, 292, 295
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
27% identity, 51% coverage: 3:145/280 of query aligns to 2:159/338 of 1udcA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), C34 (≠ A32), N35 (≠ G33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (= F70), A81 (= A71), G82 (= G72), K84 (vs. gap), S122 (≠ A108), Y149 (= Y135), K153 (= K139)
- binding uridine-5'-diphosphate-mannose: T126 (≠ H112), Y149 (= Y135)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-5'-diphosphate-mannose: 179, 199, 200, 215, 216, 217, 218, 231, 233, 269, 292
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
27% identity, 51% coverage: 3:145/280 of query aligns to 2:159/338 of P09147
- YI 11:12 (≠ QL 12:13) binding
- DNLCNS 31:36 (≠ RSAAGS 29:34) binding
- DI 58:59 (≠ DL 50:51) binding
- FAGLK 80:84 (≠ FAG-- 70:72) binding
- N99 (= N85) binding
- S124 (= S110) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y135) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K139) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
Sites not aligning to the query:
- 178 binding
- 299 Y→C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
27% identity, 51% coverage: 3:145/280 of query aligns to 2:159/338 of 1udaA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), L33 (≠ A31), C34 (≠ A32), N35 (≠ G33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (= F70), A81 (= A71), G82 (= G72), K84 (vs. gap), S122 (≠ A108), Y149 (= Y135), K153 (= K139)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (≠ H112)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: 179, 199, 200, 216, 217, 218, 231, 233, 292, 295, 299
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
27% identity, 51% coverage: 3:145/280 of query aligns to 2:159/338 of 1naiA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), L33 (≠ A31), C34 (≠ A32), N35 (≠ G33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (= F70), A81 (= A71), G82 (= G72), K84 (vs. gap), Y149 (= Y135), K153 (= K139)
- binding 1,3-propandiol: N35 (≠ G33), K84 (vs. gap)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding 1,3-propandiol: 191, 193
- binding uridine-5'-diphosphate: 179, 199, 200, 215, 216, 231, 233, 292
Query Sequence
>H281DRAFT_05310 FitnessBrowser__Burk376:H281DRAFT_05310
MKKIALSGAGGQLGSVVRAAFIARGKPLRSAAGSKPLTPLVEGEDVMHGDLRDPAVVDRL
LDGVDVLIHFAGTSVERPLPEIIENNLRGLVEVYEGARRHGVKRIVFASSNHAIGMYPVT
ERLSLDCELRPDGFYGLSKVWGEALARMYWDKHGIESVCVRIGSCLERPTEPRHLSTWFG
HADLMHFLDRCIEAEDLGFITVWGVSANTRSWWDNSGAERLGYMPKQNAEDYADEVLARP
NPLDAFGQRFQGGGFVGIDYSRDDADSGAGDAAASAARPS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory