SitesBLAST
Comparing H281DRAFT_05314 FitnessBrowser__Burk376:H281DRAFT_05314 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
43% identity, 91% coverage: 3:271/297 of query aligns to 15:284/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G8), L21 (= L9), G22 (= G10), I23 (= I11), M24 (= M12), N43 (≠ T31), R44 (= R32), T45 (≠ S33), K48 (≠ V35), V77 (= V64), S78 (≠ P65), D82 (= D69), Q85 (≠ R72), V133 (= V120), F244 (= F231), K245 (≠ R232), H248 (≠ L235), K251 (= K238)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
43% identity, 91% coverage: 3:271/297 of query aligns to 15:281/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G8), L21 (= L9), G22 (= G10), I23 (= I11), M24 (= M12), N43 (≠ T31), R44 (= R32), T45 (≠ S33), K48 (≠ V35), M76 (= M63), V77 (= V64), S78 (≠ P65), D82 (= D69), Q85 (≠ R72), V133 (= V120), F241 (= F231), K242 (≠ R232), H245 (≠ L235), K248 (= K238)
- binding sulfate ion: T134 (≠ S121), G135 (= G122), K183 (= K170)
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
33% identity, 95% coverage: 5:285/297 of query aligns to 42:330/335 of P29266
- D68 (≠ S33) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K170) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q174) mutation to Q: Decrease in activity.
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
33% identity, 96% coverage: 2:285/297 of query aligns to 2:286/287 of 3pefA
- binding glycerol: D67 (= D66), G123 (= G122), K171 (= K170), N175 (≠ Q174), M178 (≠ V177), L203 (≠ R202), G207 (≠ M206), N213 (≠ S212), A217 (≠ E216), F232 (= F231), H236 (≠ L235), K239 (= K238), R242 (≠ N241), R269 (≠ V268)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), I11 (= I11), M12 (= M12), N31 (≠ T31), R32 (= R32), S33 (= S33), K36 (≠ P36), M64 (= M63), L65 (≠ V64), A66 (≠ P65), A70 (≠ D69), E73 (≠ R72), T96 (≠ S95), V121 (= V120), G123 (= G122), S124 (≠ G123), A231 (≠ G230), F232 (= F231), H236 (≠ L235), K239 (= K238)
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
34% identity, 96% coverage: 1:285/297 of query aligns to 1:286/287 of 3pduA
- binding glycerol: R242 (≠ N241), E246 (≠ Q245), E246 (≠ Q245), R250 (≠ T249)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), G10 (= G10), I11 (= I11), M12 (= M12), N31 (≠ T31), R32 (= R32), N33 (≠ S33), M64 (= M63), L65 (≠ V64), A66 (≠ P65), A70 (≠ D69), T96 (≠ S95), V121 (= V120), G123 (= G122), T124 (≠ G123), K171 (= K170), S231 (≠ G230), F232 (= F231), P233 (≠ R232), H236 (≠ L235), K239 (= K238)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
33% identity, 95% coverage: 5:285/297 of query aligns to 43:331/336 of P31937
- LP 103:104 (≠ VP 64:65) binding
- N108 (≠ D69) binding
- T134 (≠ S95) binding
- K284 (= K238) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
33% identity, 94% coverage: 5:284/297 of query aligns to 4:291/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), N10 (≠ I11), M11 (= M12), Y29 (≠ F30), D30 (≠ S33), V31 (≠ A34), M63 (= M63), L64 (≠ V64), P65 (= P65), T95 (≠ S95), V120 (= V120), G122 (= G122), F238 (= F231), K245 (= K238)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
29% identity, 96% coverage: 1:284/297 of query aligns to 3:289/294 of 5je8B
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
35% identity, 98% coverage: 1:292/297 of query aligns to 1:288/289 of 2cvzC
- active site: S117 (= S121), K165 (= K170), N168 (= N173), N169 (≠ Q174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), L9 (= L9), G10 (= G10), A11 (≠ I11), M12 (= M12), N30 (vs. gap), R31 (vs. gap), T32 (≠ A29), C62 (≠ M63), L63 (≠ V64), P64 (= P65), E68 (≠ D69), E71 (≠ R72), S91 (= S95), V116 (= V120), F227 (= F231), K234 (= K238)
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
35% identity, 98% coverage: 2:292/297 of query aligns to 1:287/288 of 1wp4A
- active site: S116 (= S121), K164 (= K170), N167 (= N173), N168 (≠ Q174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G8), L8 (= L9), G9 (= G10), A10 (≠ I11), M11 (= M12), N29 (vs. gap), R30 (vs. gap), T31 (≠ A29), K34 (≠ R32), C61 (≠ M63), L62 (≠ V64), P63 (= P65), E67 (≠ D69), S90 (= S95), V115 (= V120), T225 (≠ G230), F226 (= F231), K233 (= K238)
- binding sulfate ion: S116 (= S121), G117 (= G122), G118 (= G123), K164 (= K170)
2uyyA Structure of the cytokine-like nuclear factor n-pac
29% identity, 95% coverage: 2:283/297 of query aligns to 7:289/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G10), L16 (≠ I11), M17 (= M12), N36 (≠ T31), R37 (= R32), T38 (≠ S33), V70 (= V64), S71 (≠ P65), A75 (≠ D69), T101 (≠ S95), F237 (= F231), Y238 (≠ R232), Y241 (≠ L235), K244 (= K238)
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
39% identity, 81% coverage: 1:242/297 of query aligns to 1:250/298 of Q9I5I6
- 2:31 (vs. 2:30, 57% identical) binding
- P66 (= P65) binding
- T96 (≠ S95) binding ; mutation to A: Almost abolished activity.
- S122 (= S121) mutation to A: Strongly reduced activity.
- K171 (= K170) active site
- N175 (≠ Q174) mutation to A: Strongly reduced activity.
- W214 (≠ R213) mutation to A: Almost abolished activity.
- Y219 (≠ H218) mutation to A: Strongly reduced activity.
- K246 (= K238) binding ; mutation to A: Almost abolished activity.
- D247 (= D239) mutation to A: Almost abolished activity.
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
32% identity, 97% coverage: 1:288/297 of query aligns to 1:290/298 of P0A9V8
- QM 11:12 (≠ IM 11:12) binding
- D31 (≠ T31) binding
- L65 (≠ V64) binding
- T96 (≠ S95) binding
- G122 (≠ S121) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G122) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G123) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NQVIV 173:177) binding
- K240 (= K238) binding
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
29% identity, 95% coverage: 2:284/297 of query aligns to 268:551/553 of Q49A26
- 271:285 (vs. 5:19, 53% identical) binding
- T362 (≠ S95) binding
- M437 (≠ K170) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (= P229) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K238) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
32% identity, 95% coverage: 6:288/297 of query aligns to 5:289/294 of 6smyA
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
32% identity, 95% coverage: 6:288/297 of query aligns to 5:289/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), Q10 (≠ I11), M11 (= M12), F29 (= F30), D30 (≠ T31), V31 (≠ R32), M63 (= M63), L64 (≠ V64), V73 (= V73), S94 (= S94), T95 (≠ S95), R122 (≠ G122)
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
39% identity, 81% coverage: 2:242/297 of query aligns to 1:248/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), H10 (≠ I11), M11 (= M12), F29 (= F30), D30 (vs. gap), L31 (vs. gap), M63 (= M63), L64 (≠ V64), P65 (= P65), T94 (≠ S95), V119 (= V120), G121 (= G122), F237 (= F231), K244 (= K238)
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
28% identity, 95% coverage: 2:284/297 of query aligns to 267:544/546 of Q922P9
- P489 (= P229) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
39% identity, 81% coverage: 1:242/297 of query aligns to 1:249/295 of 3obbA
Q8T079 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60 homolog; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1 homolog from Drosophila melanogaster (Fruit fly) (see paper)
28% identity, 94% coverage: 2:280/297 of query aligns to 316:596/602 of Q8T079
Sites not aligning to the query:
- 8 modified: Phosphoserine
- 10 modified: Phosphoserine
- 224 modified: Phosphoserine
- 228 modified: Phosphoserine
- 243 modified: Phosphoserine
Query Sequence
>H281DRAFT_05314 FitnessBrowser__Burk376:H281DRAFT_05314
MQKAGFIGLGIMGKPMAANLLKNGVTLAAFTRSAVPDDLTQAGAQACDSPAAVAAQADVI
FIMVPDTPDVERVLFGENGLASGLRAGQTVVDMSSISPMATRDFAARVRETGADYLDAPV
SGGEVGAKAGSLTIMVGGEQATFDSVKPLFDMMGKNVTLIGAVGAGQVCKVANQVIVAAT
IEAVGEALLLASKAGVDPARVREALMGGFASSRILEVHGERMTKRTFDPGFRIELHQKDL
NLALQTAQTLGVSLPNTATCQALFNACVAHGGKAWDHSAMVRALEVLANHEIGQQTT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory