Comparing H281DRAFT_05319 FitnessBrowser__Burk376:H281DRAFT_05319 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ur8A Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid (see paper)
54% identity, 98% coverage: 4:301/305 of query aligns to 3:298/304 of 4ur8A
5hwnB Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate (see paper)
54% identity, 98% coverage: 4:301/305 of query aligns to 3:298/310 of 5hwnB
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
26% identity, 93% coverage: 20:303/305 of query aligns to 10:292/296 of 7mjfA
Sites not aligning to the query:
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
26% identity, 93% coverage: 20:303/305 of query aligns to 10:292/296 of 7lvlA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
28% identity, 95% coverage: 13:303/305 of query aligns to 3:291/294 of Q8UGL3
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
29% identity, 95% coverage: 13:303/305 of query aligns to 3:289/292 of Q07607
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
27% identity, 95% coverage: 13:303/305 of query aligns to 3:291/294 of 4i7wA
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
27% identity, 94% coverage: 15:302/305 of query aligns to 8:292/295 of 5ktlA
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
33% identity, 55% coverage: 14:181/305 of query aligns to 6:176/296 of 4m19A
Sites not aligning to the query:
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
33% identity, 55% coverage: 14:181/305 of query aligns to 6:176/296 of 6u01B
Sites not aligning to the query:
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
33% identity, 55% coverage: 14:181/305 of query aligns to 16:186/306 of 7kkdB
5ud6C Crystal structure of dhdps from cyanidioschyzon merolae with lysine bound
29% identity, 84% coverage: 41:295/305 of query aligns to 34:288/299 of 5ud6C
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
33% identity, 55% coverage: 14:181/305 of query aligns to 6:176/296 of 7kg2A
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
26% identity, 93% coverage: 20:303/305 of query aligns to 11:291/293 of 5t25A
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
26% identity, 93% coverage: 20:303/305 of query aligns to 10:290/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
26% identity, 93% coverage: 20:303/305 of query aligns to 10:290/292 of P0A6L2
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
24% identity, 93% coverage: 20:303/305 of query aligns to 11:293/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
24% identity, 93% coverage: 20:303/305 of query aligns to 10:292/294 of Q9X1K9
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
27% identity, 95% coverage: 5:295/305 of query aligns to 3:286/307 of 4fhaA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
26% identity, 91% coverage: 13:290/305 of query aligns to 3:276/291 of 4dxvA
>H281DRAFT_05319 FitnessBrowser__Burk376:H281DRAFT_05319
MTTPQELKQIVSQGLLSFPVTDFDEKGDFRADTYAERLEWLAPYGASALFVAGGTGEFFS
LTHDDYSNVVRTATEVCKGKVPILAGAGGPTRVAIAYAKEAERHGANGILLMPHYLTEAC
QEGIAAHAEEVCKSVPNMGVIIYNRANSKLNADMLEGLAERCPNLIGFKDGVGEIENMVT
IRRRLGDRFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAMDFYRAIAADDHATV
GKLIDEFFLPYLKIRNRRAGYAVSIVKAGAKLVGHSAGPVRAPLTDLTEEEMAQLDALIK
TLGPQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory