SitesBLAST
Comparing H281DRAFT_05321 FitnessBrowser__Burk376:H281DRAFT_05321 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7CRQ0 Uronate dehydrogenase; D-galacturonate dehydrogenase; D-glucuronate dehydrogenase; Hexuronate dehydrogenase; EC 1.1.1.203 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
48% identity, 92% coverage: 15:271/280 of query aligns to 1:257/265 of Q7CRQ0
- Y134 (= Y148) mutation to A: 0.1% of wild-type activity.
3rfvA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens complexed with nadh and product (see paper)
48% identity, 92% coverage: 15:271/280 of query aligns to 2:258/265 of 3rfvA
- binding D-galactaro-1,5-lactone: S74 (= S87), S110 (= S123), N111 (= N124), H112 (= H125), Y135 (= Y148), S164 (= S177), R173 (= R186), F257 (= F270)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G22), G12 (= G25), Q13 (≠ N26), L14 (= L27), D33 (= D46), L34 (≠ I47), D50 (= D63), L51 (= L64), L70 (= L83), G71 (= G84), G72 (= G85), S74 (= S87), A108 (= A121), S110 (= S123), Y135 (= Y148), K139 (= K152), I162 (= I175), S164 (= S177), C165 (≠ S178)
3rfxA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with NAD (see paper)
48% identity, 92% coverage: 15:271/280 of query aligns to 2:258/265 of 3rfxA
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
37% identity, 56% coverage: 18:175/280 of query aligns to 3:160/328 of 4id9B
- active site: S107 (= S123), Y133 (= Y148), K137 (= K152)
- binding nicotinamide-adenine-dinucleotide: G10 (= G25), R11 (≠ N26), V12 (≠ L27), D31 (= D46), L32 (≠ I47), S45 (≠ D63), L46 (= L64), L65 (= L83), A67 (≠ G85), V82 (≠ A98), Y133 (= Y148), K137 (= K152), F160 (≠ I175)
Sites not aligning to the query:
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
37% identity, 56% coverage: 18:175/280 of query aligns to 2:159/321 of 4id9A
- active site: S106 (= S123), Y132 (= Y148), K136 (= K152)
- binding nicotinamide-adenine-dinucleotide: G9 (= G25), R10 (≠ N26), V11 (≠ L27), D30 (= D46), L31 (≠ I47), R32 (≠ A48), S44 (≠ D63), L45 (= L64), L64 (= L83), A66 (≠ G85), V81 (≠ A98), S106 (= S123), Y132 (= Y148), K136 (= K152), F159 (≠ I175)
Sites not aligning to the query:
3a1nA Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
27% identity, 69% coverage: 18:209/280 of query aligns to 2:203/315 of 3a1nA
- active site: T112 (≠ S123), Y137 (= Y148), K141 (= K152)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A24), G9 (= G25), Q10 (≠ N26), I11 (≠ L27), D32 (≠ E52), I33 (≠ V53), L46 (≠ V62), D47 (= D63), L69 (= L83), A70 (≠ G84), G71 (= G85), L73 (≠ S87), S111 (= S122), Y137 (= Y148), K141 (= K152), Y164 (≠ I175)
3a4vA Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
27% identity, 69% coverage: 18:209/280 of query aligns to 2:203/311 of 3a4vA
- active site: T112 (≠ S123), Y137 (= Y148), K141 (= K152)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A24), G9 (= G25), Q10 (≠ N26), I11 (≠ L27), D32 (≠ E52), I33 (≠ V53), L46 (≠ V62), D47 (= D63), V48 (≠ L64), L69 (= L83), A70 (≠ G84), G71 (= G85), L73 (≠ S87), P110 (≠ A121), S111 (= S122), T112 (≠ S123), Y137 (= Y148), K141 (= K152), Y164 (≠ I175), I167 (≠ S178)
- binding pyruvic acid: S74 (≠ V88), Y137 (= Y148), T178 (≠ V189), T179 (= T190)
Sites not aligning to the query:
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
32% identity, 60% coverage: 17:185/280 of query aligns to 2:180/307 of 6wjaA
- active site: A118 (≠ S123), A119 (≠ N124), A120 (≠ H125), F143 (≠ Y148), K147 (= K152)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), F11 (≠ N26), I12 (≠ L27), D31 (= D46), D32 (≠ I47), S34 (≠ P49), T35 (≠ L50), G36 (= G51), A55 (≠ L64), L74 (= L83), A75 (≠ G84), A76 (≠ G85), S93 (≠ A98), F143 (≠ Y148), K147 (= K152), F170 (≠ I175), F171 (≠ G176), I173 (≠ S178)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V88), A120 (≠ H125), N172 (≠ S177)
Sites not aligning to the query:
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
32% identity, 60% coverage: 17:185/280 of query aligns to 3:181/308 of 6wj9B
- active site: A119 (≠ S123), A120 (≠ N124), A121 (≠ H125), F144 (≠ Y148), K148 (= K152)
- binding nicotinamide-adenine-dinucleotide: G8 (= G22), G11 (= G25), F12 (≠ N26), I13 (≠ L27), D32 (= D46), D33 (≠ I47), S35 (≠ P49), T36 (≠ L50), G37 (= G51), D55 (= D63), A56 (≠ L64), L75 (= L83), A76 (≠ G84), A77 (≠ G85), S94 (≠ A98), A117 (= A121), A119 (≠ S123), F144 (≠ Y148), K148 (= K152), F171 (≠ I175), F172 (≠ G176), I174 (≠ S178)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V88), N173 (≠ S177)
Sites not aligning to the query:
3ajrA Crystal structure of l-3-hydroxynorvaline bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
27% identity, 69% coverage: 18:209/280 of query aligns to 2:203/314 of 3ajrA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A24), G9 (= G25), Q10 (≠ N26), I11 (≠ L27), D32 (≠ E52), I33 (≠ V53), L46 (≠ V62), D47 (= D63), V48 (≠ L64), L69 (= L83), A70 (≠ G84), G71 (= G85), L73 (≠ S87), P110 (≠ A121), S111 (= S122), T112 (≠ S123), F137 (≠ Y148), K141 (= K152), Y164 (≠ I175), I167 (≠ S178)
- binding (3R)-3-hydroxy-L-norvaline: S74 (≠ V88), T112 (≠ S123), I113 (≠ N124), F137 (≠ Y148), G177 (≠ L188), T178 (≠ V189), T179 (= T190)
3a9wA Crystal structure of l-threonine bound l-threonine dehydrogenase (y137f) from hyperthermophilic archaeon thermoplasma volcanium (see paper)
27% identity, 69% coverage: 18:209/280 of query aligns to 2:203/315 of 3a9wA
- binding nicotinamide-adenine-dinucleotide: S8 (≠ A24), G9 (= G25), Q10 (≠ N26), I11 (≠ L27), D32 (≠ E52), I33 (≠ V53), L46 (≠ V62), D47 (= D63), V48 (≠ L64), L69 (= L83), A70 (≠ G84), L73 (≠ S87), V87 (≠ A98), P110 (≠ A121), S111 (= S122), K141 (= K152), Y164 (≠ I175), I167 (≠ S178)
- binding threonine: S74 (≠ V88), T112 (≠ S123), F137 (≠ Y148), G177 (≠ L188), T178 (≠ V189), T179 (= T190)
7cgvA Full consensus l-threonine 3-dehydrogenase, fctdh-iiym (NAD+ bound form) (see paper)
29% identity, 57% coverage: 16:174/280 of query aligns to 1:165/310 of 7cgvA
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), G10 (= G25), Q11 (≠ N26), I12 (≠ L27), D33 (= D46), I34 (= I47), R35 (≠ A48), L48 (≠ V62), D49 (= D63), V50 (≠ L64), A72 (≠ G84), A73 (≠ G85), L75 (vs. gap), P112 (≠ A121), S114 (= S123), Y139 (= Y148), K143 (= K152)
Sites not aligning to the query:
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
28% identity, 61% coverage: 16:185/280 of query aligns to 17:203/336 of 3ruhA
- active site: S142 (= S123), S143 (≠ N124), S144 (≠ H125), Y166 (= Y148), K170 (= K152)
- binding nicotinamide-adenine-dinucleotide: G23 (= G22), G26 (= G25), F27 (≠ N26), I28 (≠ L27), D47 (= D46), N48 (≠ I47), S50 (≠ P49), T51 (≠ L50), G52 (= G51), D78 (= D63), I79 (≠ L64), Q98 (≠ L83), A99 (≠ G84), A100 (≠ G85), T117 (vs. gap), A140 (= A121), A141 (≠ S122), S142 (= S123), Y166 (= Y148), K170 (= K152), Y193 (≠ I175), V196 (≠ S178)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (vs. gap), S103 (= S87), S142 (= S123), S143 (≠ N124), S144 (≠ H125), Y166 (= Y148), Y193 (≠ I175), N195 (≠ S177)
Sites not aligning to the query:
- active site: 204
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: 209, 210, 213, 214, 225, 226, 227, 234, 271, 294, 297, 298, 301
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
28% identity, 61% coverage: 16:185/280 of query aligns to 17:203/336 of 3rufA
- active site: S142 (= S123), S143 (≠ N124), S144 (≠ H125), Y166 (= Y148), K170 (= K152)
- binding nicotinamide-adenine-dinucleotide: G23 (= G22), G26 (= G25), F27 (≠ N26), I28 (≠ L27), D47 (= D46), N48 (≠ I47), S50 (≠ P49), T51 (≠ L50), G52 (= G51), D78 (= D63), I79 (≠ L64), Q98 (≠ L83), A99 (≠ G84), A100 (≠ G85), T117 (vs. gap), A140 (= A121), Y166 (= Y148), K170 (= K152), Y193 (≠ I175), V196 (≠ S178)
- binding uridine-5'-diphosphate: N195 (≠ S177)
Sites not aligning to the query:
- active site: 204
- binding uridine-5'-diphosphate: 209, 210, 213, 214, 225, 226, 227, 234, 271, 294, 297
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
28% identity, 61% coverage: 16:185/280 of query aligns to 17:203/336 of 3lu1A
- active site: S142 (= S123), S143 (≠ N124), S144 (≠ H125), Y166 (= Y148), K170 (= K152)
- binding glycine: Q135 (≠ K116), K187 (≠ E169)
- binding nicotinamide-adenine-dinucleotide: G23 (= G22), G26 (= G25), F27 (≠ N26), I28 (≠ L27), D47 (= D46), N48 (≠ I47), S50 (≠ P49), T51 (≠ L50), G52 (= G51), D78 (= D63), I79 (≠ L64), Q98 (≠ L83), A99 (≠ G84), A100 (≠ G85), A140 (= A121), A141 (≠ S122), S142 (= S123), Y166 (= Y148), K170 (= K152), Y193 (≠ I175), N195 (≠ S177)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S87), S142 (= S123), S143 (≠ N124), S144 (≠ H125), Y166 (= Y148), N195 (≠ S177)
Sites not aligning to the query:
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
28% identity, 61% coverage: 16:185/280 of query aligns to 20:206/345 of Q7BJX9
Sites not aligning to the query:
- 213:216 binding
- 228:230 binding
- 236 S→G: No effect on epimerase activity.
- 237 binding
- 271 R→G: No effect on epimerase activity.
- 302:305 binding
- 307 R→A: No effect on epimerase activity.
- 308 H→A: No effect on epimerase activity.
- 309 S→Y: Abolishes epimerase activity.
3eheA Crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus
28% identity, 57% coverage: 18:177/280 of query aligns to 2:164/290 of 3eheA
- active site: T111 (≠ S123), S112 (≠ N124), T113 (≠ H125), Y135 (= Y148), K139 (= K152)
- binding nicotinamide-adenine-dinucleotide: G6 (= G22), G9 (= G25), F10 (≠ N26), I11 (≠ L27), D29 (≠ T45), N30 (≠ D46), L31 (≠ I47), S32 (≠ A48), S33 (≠ P49), G34 (≠ L50), D49 (= D66), L50 (≠ E67), I68 (≠ L83), A69 (≠ G84), A70 (≠ G85), T109 (≠ A121), Y135 (= Y148), K139 (= K152), F162 (≠ I175), A163 (≠ G176), N164 (≠ S177)
Sites not aligning to the query:
6jygD Crystal structure of l-threonine dehydrogenase from phytophthora infestans (see paper)
30% identity, 56% coverage: 17:174/280 of query aligns to 2:162/307 of 6jygD
- binding citrate anion: Q11 (≠ N26), L73 (≠ S87), S74 (≠ V88), Y136 (= Y148)
- binding nicotinamide-adenine-dinucleotide: G7 (= G22), T9 (≠ A24), G10 (= G25), Q11 (≠ N26), I12 (≠ L27), D33 (= D46), I34 (= I47), K35 (≠ A48), D47 (≠ A60), V48 (≠ I61), M69 (≠ L83), A70 (≠ G84), S71 (≠ G85), L73 (≠ S87), V87 (≠ A98), P109 (≠ S122), S110 (= S123), T111 (≠ N124), Y136 (= Y148), K140 (= K152)
Sites not aligning to the query:
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
28% identity, 61% coverage: 17:187/280 of query aligns to 3:189/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G22), G11 (= G25), F12 (≠ N26), I13 (≠ L27), D32 (= D33), N33 (≠ A34), N35 (≠ A36), Y38 (≠ A39), K43 (≠ R43), D61 (= D63), L62 (= L64), L83 (= L83), A84 (≠ G84), A85 (vs. gap), A123 (= A121), Y150 (= Y148), K154 (= K152), F177 (≠ I175), V180 (≠ S178), R186 (≠ N184), M189 (= M187)
Q9FX01 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1; At3BETAHSD/D1; 4alpha-carboxysterol-C3-dehydrogenase/C4-decarboxylase isoform 1-1; Reticulon-like protein B24; AtRTNLB24; Sterol-4-alpha-carboxylate 3-dehydrogenase 1, decarboxylating; EC 1.1.1.418 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 59% coverage: 16:179/280 of query aligns to 10:192/439 of Q9FX01
- D41 (= D46) Essential for the 3betaHSD/D activity; mutation to V: Lost activity.
- D72 (= D63) Essential for the 3betaHSD/D activity; mutation D->A,V: Lost activity.
- T131 (≠ A121) Essential for the 3betaHSD/D activity; mutation to V: Lost activity.
- S133 (= S123) mutation to A: Reduced activity with slower catalysis and lower substrate binding.
- S135 (≠ H125) mutation to A: Normal activity, but slower catalysis with 4alpha-carboxysterol as substrate.; mutation to T: Altered activity due to reduced affinity and catalysis and leading to lower amount of C4-demethylated sterols and higher quantities of 4,4-dimethylated sterol intermediates, and a higher ratio of 4,4-dimethylsterols to 4alpha-methylsterols.; mutation to Y: Altered activity leading to an exclusive production of C4-methylated sterols and 4alpha-carboxy-3beta-hydroxy sterols.
- Y161 (= Y148) Essential for the 3betaHSD/D activity; mutation to F: Lost activity.
- K165 (= K152) Essential for the 3betaHSD/D activity; mutation to I: Lost activity.
Sites not aligning to the query:
- 320 R→I: Normal activity.
- 328 Essential for the 3betaHSD/D activity; R→I: Lost activity.
Query Sequence
>H281DRAFT_05321 FitnessBrowser__Burk376:H281DRAFT_05321
MTDSNSDRAAAQKPFRRLLLTGAAGNLGTQLRDALAAWADVVRVTDIAPLGEVADHEEAA
IVDLADEAAVHALLEGVDAVIHLGGISVEAPFEDLLEANIRGLYNLYSAAQKQGVKRVVY
ASSNHTVGFHPVTEVVDIDAPLRPDSLYGVTKCFGESLSRYYFDRFGLETVCLRIGSSFE
QPKNPRMLVTYLSYRDFIELVRCSLFTNRVGHAIVYGVSDNRTKWVDNTKAAFLGFRPQD
SSVQFEHLFPVAASTADLDDPTQRFQGGAFVLAGPMEPKR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory