SitesBLAST
Comparing H281DRAFT_05383 FitnessBrowser__Burk376:H281DRAFT_05383 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
38% identity, 92% coverage: 27:310/310 of query aligns to 27:310/311 of 3bazA
- active site: L98 (≠ N99), R230 (= R230), A251 (= A251), D254 (= D254), E259 (= E259), H277 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ A75), G149 (= G149), L150 (= L150), G151 (= G151), R152 (≠ N152), I153 (= I153), S172 (≠ N172), R173 (= R173), S174 (≠ K174), C201 (≠ T201), P202 (= P202), T207 (= T207), I228 (≠ V228), G229 (≠ S229), R230 (= R230), D254 (= D254), H277 (= H277), G279 (= G279)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
38% identity, 92% coverage: 27:310/310 of query aligns to 29:312/313 of Q65CJ7
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
42% identity, 81% coverage: 61:310/310 of query aligns to 58:310/319 of 5v6qB
- active site: L96 (≠ N99), R230 (= R230), D254 (= D254), E259 (= E259), H277 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V72 (≠ A75), V100 (= V103), F148 (≠ V148), L150 (= L150), G151 (= G151), R152 (≠ N152), I153 (= I153), T172 (≠ N172), R173 (= R173), V201 (≠ T201), P202 (= P202), S206 (≠ G206), T207 (= T207), V228 (= V228), G229 (≠ S229), R230 (= R230), H277 (= H277), A279 (≠ G279)
5j23A Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with 2'-phospho-adp-ribose (see paper)
42% identity, 81% coverage: 61:310/310 of query aligns to 56:308/318 of 5j23A
- active site: L94 (≠ N99), R228 (= R230), D252 (= D254), E257 (= E259), H275 (= H277)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: V70 (≠ A75), L148 (= L150), G149 (= G151), R150 (≠ N152), I151 (= I153), T170 (≠ N172), R171 (= R173), P200 (= P202), S204 (≠ G206), T205 (= T207), R228 (= R230)
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
42% identity, 81% coverage: 61:310/310 of query aligns to 57:309/319 of 5v7nA
- active site: L95 (≠ N99), R229 (= R230), D253 (= D254), E258 (= E259), H276 (= H277)
- binding 2-keto-D-gluconic acid: G70 (= G74), V71 (≠ A75), G72 (= G76), R229 (= R230), H276 (= H277), S279 (≠ G280), R285 (≠ I286)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V71 (≠ A75), V99 (= V103), L149 (= L150), G150 (= G151), R151 (≠ N152), I152 (= I153), T171 (≠ N172), R172 (= R173), V200 (≠ T201), P201 (= P202), S205 (≠ G206), T206 (= T207), V227 (= V228), G228 (≠ S229), R229 (= R230), H276 (= H277), A278 (≠ G279)
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
42% identity, 81% coverage: 61:310/310 of query aligns to 56:308/317 of 5v7gA
- active site: L94 (≠ N99), R228 (= R230), D252 (= D254), E257 (= E259), H275 (= H277)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (≠ A75), V98 (= V103), F146 (≠ V148), L148 (= L150), G149 (= G151), R150 (≠ N152), I151 (= I153), T170 (≠ N172), R171 (= R173), V199 (≠ T201), P200 (= P202), S204 (≠ G206), T205 (= T207), V226 (= V228), G227 (≠ S229), R228 (= R230), H275 (= H277), A277 (≠ G279)
- binding oxalate ion: G69 (= G74), V70 (≠ A75), G71 (= G76), R228 (= R230), H275 (= H277)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
36% identity, 84% coverage: 45:304/310 of query aligns to 46:315/334 of 5aovA
- active site: L100 (≠ N99), R241 (= R230), D265 (= D254), E270 (= E259), H288 (= H277)
- binding glyoxylic acid: M52 (≠ N51), L53 (≠ G52), L53 (≠ G52), Y74 (≠ L73), A75 (≠ G74), V76 (≠ A75), G77 (= G76), R241 (= R230), H288 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A75), T104 (≠ V103), F158 (≠ L150), G159 (= G151), R160 (≠ N152), I161 (= I153), S180 (≠ N172), R181 (= R173), A211 (= A200), V212 (≠ T201), P213 (= P202), T218 (= T207), I239 (≠ V228), A240 (≠ S229), R241 (= R230), H288 (= H277), G290 (= G279)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
40% identity, 76% coverage: 45:280/310 of query aligns to 45:290/332 of 6biiA
- active site: L99 (≠ N99), R240 (= R230), D264 (= D254), E269 (= E259), H287 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ A75), T103 (≠ V103), G156 (= G149), F157 (≠ L150), G158 (= G151), R159 (≠ N152), I160 (= I153), A179 (vs. gap), R180 (≠ H171), S181 (≠ N172), K183 (= K174), V211 (≠ T201), P212 (= P202), E216 (≠ G206), T217 (= T207), V238 (= V228), A239 (≠ S229), R240 (= R230), D264 (= D254), H287 (= H277), G289 (= G279)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
36% identity, 91% coverage: 1:282/310 of query aligns to 1:293/334 of O58320
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
36% identity, 91% coverage: 1:282/310 of query aligns to 1:293/333 of 2dbqA
- active site: L100 (≠ N99), R241 (= R230), D265 (= D254), E270 (= E259), H288 (= H277)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A75), T104 (≠ V103), L158 (= L150), G159 (= G151), R160 (≠ N152), I161 (= I153), S180 (≠ N172), R181 (= R173), T182 (≠ K174), A211 (= A200), V212 (≠ T201), P213 (= P202), T218 (= T207), I239 (≠ V228), A240 (≠ S229), R241 (= R230), D265 (= D254), H288 (= H277), G290 (= G279)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
34% identity, 78% coverage: 45:285/310 of query aligns to 42:286/304 of 1wwkA
- active site: S96 (≠ N99), R230 (= R230), D254 (= D254), E259 (= E259), H278 (= H277)
- binding nicotinamide-adenine-dinucleotide: V100 (= V103), G146 (= G149), F147 (≠ L150), G148 (= G151), R149 (≠ N152), I150 (= I153), Y168 (≠ H171), D169 (≠ N172), P170 (≠ R173), V201 (≠ T201), P202 (= P202), T207 (= T207), T228 (≠ V228), S229 (= S229), D254 (= D254), H278 (= H277), G280 (= G279)
2w2lA Crystal structure of the holo forms of rhodotorula graminis d- mandelate dehydrogenase at 2.5a.
32% identity, 86% coverage: 43:309/310 of query aligns to 54:337/346 of 2w2lA
- active site: G113 (≠ N99), R257 (= R230), D281 (= D254), E286 (= E259), H304 (= H277)
- binding nicotinamide-adenine-dinucleotide: T117 (≠ V103), G172 (= G151), A173 (≠ N152), I174 (= I153), D194 (≠ N172), V228 (≠ T201), P229 (= P202), T234 (= T207), T255 (≠ V228), A256 (≠ S229), R257 (= R230), H304 (= H277), G306 (= G279), G307 (= G280)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
33% identity, 74% coverage: 56:285/310 of query aligns to 59:291/533 of O43175
- T78 (≠ A75) binding
- R135 (≠ D132) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ NI 152:153) binding
- D175 (≠ H171) binding
- T207 (= T201) binding
- CAR 234:236 (≠ VSR 228:230) binding
- D260 (= D254) binding
- V261 (= V255) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HVGG 277:280) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
33% identity, 74% coverage: 56:285/310 of query aligns to 55:287/305 of 6plfA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
33% identity, 74% coverage: 56:285/310 of query aligns to 54:286/303 of 6plgA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
33% identity, 74% coverage: 56:285/310 of query aligns to 54:286/301 of 6rj5A
7dkmA Phgdh covalently linked to oridonin (see paper)
33% identity, 74% coverage: 56:285/310 of query aligns to 55:287/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ A75), A102 (≠ V103), G148 (= G149), R151 (≠ N152), I152 (= I153), Y170 (= Y170), D171 (≠ H171), P172 (= P175), I173 (≠ R176), H202 (≠ A200), T203 (= T201), P204 (= P202), T209 (= T207), C230 (≠ V228), A231 (≠ S229), R232 (= R230), H279 (= H277), G281 (= G279)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18, 293
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
33% identity, 74% coverage: 56:285/310 of query aligns to 51:283/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G151), I148 (= I153), Y166 (= Y170), D167 (≠ H171), P168 (= P175), I169 (≠ R176), I170 (≠ E177), H198 (≠ A200), T199 (= T201), L208 (= L210), R228 (= R230)
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
33% identity, 74% coverage: 56:285/310 of query aligns to 54:286/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V148), G147 (= G149), L148 (= L150), G149 (= G151), R150 (≠ N152), I151 (= I153), G152 (= G154), D170 (≠ H171), H201 (≠ A200), T202 (= T201), P203 (= P202)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
33% identity, 74% coverage: 56:285/310 of query aligns to 54:286/302 of 6rihA
Query Sequence
>H281DRAFT_05383 FitnessBrowser__Burk376:H281DRAFT_05383
MKPSLLILIHLDDASRASIEAEFDSVYAPDPAQHAAVIATHGAMIRAVLTNGTRGISAAE
IDRMPKLEFVSALGAGYENVAVDHARSRGIVLVNGAGTNDHCVADHAFALLLSIVRDVPR
LDEATREGVWRDALPMRPDVSGKRLGIVGLGNIGEKIARRGAGFDMEIGYHNRKPREGTS
LSYFDGVEALARWCDFLVIATPGGAGTHHLIGARVFEALGPDGFVVNVSRGSVLDTAALA
QALVAGTIAGAALDVYEGEPQPPAALLKLRNVVLTPHVGGRSPDAIAAAVNNFLRNAARH
FAGEPVLTPI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory