SitesBLAST
Comparing H281DRAFT_05401 FitnessBrowser__Burk376:H281DRAFT_05401 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
46% identity, 97% coverage: 9:426/431 of query aligns to 17:436/478 of Q47945
- Q37 (≠ S30) modified: Pyrrolidone carboxylic acid
Sites not aligning to the query:
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
47% identity, 92% coverage: 32:426/431 of query aligns to 1:398/433 of 8gy2B
- binding heme c: C18 (= C49), C21 (= C52), H22 (= H53), T46 (= T77), I48 (= I79), Y59 (= Y90), L68 (≠ M99), R73 (≠ A104), V79 (≠ L110), Y80 (= Y111), M83 (= M114), F88 (≠ Y119), R126 (= R157), H165 (= H195), C166 (= C196), C169 (= C199), H170 (= H200), I201 (≠ Y229), A202 (= A230), P203 (≠ T231), L205 (= L233), W216 (= W244), F224 (= F252), A234 (≠ S262), V235 (≠ A263), F236 (= F264), F236 (= F264), M239 (= M267), N301 (≠ Y330), C302 (= C331), C305 (= C334), H306 (= H335), M316 (= M345), F317 (≠ L346), P318 (≠ A347), L320 (= L349), P324 (= P353), G342 (≠ T371), S352 (≠ A381), V354 (≠ Y383), M356 (= M385), F359 (≠ Y388), M375 (≠ V404)
- binding ubiquinone-10: C21 (= C52), L34 (= L65), P39 (= P70), P81 (= P112), L129 (= L160), W132 (= W163), E168 (≠ S198), R173 (= R203), I197 (≠ L225), D241 (≠ S269)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
38% identity, 90% coverage: 37:424/431 of query aligns to 1:386/418 of 7w2jC
- binding heme c: C13 (= C49), C16 (= C52), H17 (= H53), T42 (= T77), I44 (= I79), Y55 (= Y90), L75 (= L110), Y76 (= Y111), A78 (= A113), M79 (= M114), R122 (= R157), H161 (= H195), C162 (= C196), C165 (= C199), H166 (= H200), A191 (= A230), P192 (≠ T231), R223 (≠ S262), P227 (≠ S266), M228 (= M267), V289 (≠ Y330), C290 (= C331), C293 (= C334), H294 (= H335), Y305 (≠ L346), Y306 (≠ A347), P307 (= P348), L309 (= L349), N312 (= N352), T313 (≠ P353), T314 (≠ N354), D322 (≠ S362), I327 (≠ T367), V331 (≠ T371), R333 (≠ D373), I340 (≠ Y383), M342 (= M385), P343 (= P386), F345 (≠ Y388)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
38% identity, 90% coverage: 37:424/431 of query aligns to 1:400/413 of 8jejC
- binding heme c: C13 (= C49), C16 (= C52), H17 (= H53), T42 (= T77), I44 (= I79), F60 (= F95), L64 (≠ M99), L75 (= L110), Y76 (= Y111), M79 (= M114), P80 (= P115), Y84 (= Y119), R122 (= R157), C162 (= C196), C165 (= C199), H166 (= H200), I186 (≠ L225), W189 (= W228), A191 (= A230), P192 (≠ T231), I194 (≠ L233), W205 (= W244), Y213 (≠ F252), R223 (≠ S262), M228 (= M267), V303 (≠ Y330), C304 (= C331), C307 (= C334), H308 (= H335), Y320 (≠ A347), P321 (= P348), L323 (= L349), T327 (≠ P353), T328 (≠ N354), D336 (≠ S362), I341 (≠ T367), V345 (≠ T371), R347 (≠ D373), I354 (vs. gap), M356 (≠ I379), F359 (≠ P382), I376 (≠ V400)
- binding ubiquinone-10: M36 (= M71), P77 (= P112), S124 (≠ P159), W128 (= W163), C165 (= C199), L173 (= L212)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
33% identity, 88% coverage: 28:405/431 of query aligns to 32:408/440 of 8gy3A
- binding heme c: Y52 (≠ D48), C53 (= C49), C56 (= C52), H57 (= H53), S84 (≠ T77), I86 (= I79), W97 (≠ Y90), F102 (= F95), L117 (= L110), F121 (≠ M114), F126 (≠ Y119), R163 (= R157), C203 (= C196), C206 (= C199), H207 (= H200), A232 (= A230), P233 (≠ T231), L235 (= L233), W245 (= W244), Y253 (≠ F252), L254 (= L253), G263 (≠ A261), S264 (= S262), M269 (= M267), Y292 (≠ L290), C337 (= C331), C340 (= C334), H341 (= H335), P353 (= P353), L355 (≠ V355), N358 (≠ K358), N359 (≠ D359), V372 (≠ L374), I377 (= I379), G382 (vs. gap), Q383 (vs. gap), I386 (≠ Y383), M388 (= M385), F391 (≠ Y388)
- binding ubiquinone-10: E55 (≠ A51), T76 (= T69), F78 (≠ M71), Y118 (= Y111), P119 (= P112), I160 (≠ M154), G166 (≠ L160), Q167 (≠ K161), F169 (≠ L162), W170 (= W163), H202 (= H195), R210 (= R203), L213 (≠ A206)
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
37% identity, 23% coverage: 324:424/431 of query aligns to 23:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C331), C33 (= C334), H34 (= H335), Y46 (≠ A347), P47 (= P348), T54 (≠ N354), V66 (= V366), I67 (≠ T367), R73 (≠ D373), I80 (= I376), M82 (= M385), P83 (= P386)
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
35% identity, 27% coverage: 307:424/431 of query aligns to 321:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C331), C350 (= C334), H351 (= H335), F362 (≠ L346), P363 (≠ A347), P364 (= P348), L365 (= L349), S368 (vs. gap), Y370 (vs. gap), I382 (≠ L356), L386 (≠ A360), S387 (= S361), G388 (≠ S362), I390 (= I364), V392 (vs. gap), Y397 (≠ L368), N398 (= N369), G399 (= G370), V400 (≠ T371), M401 (= M385)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
32% identity, 24% coverage: 322:424/431 of query aligns to 354:455/457 of 4ax3D
- binding heme c: C363 (= C331), C366 (= C334), H367 (= H335), P379 (≠ A347), P380 (= P348), L381 (= L349), S384 (≠ N352), F386 (≠ V355), N403 (≠ E372), G404 (vs. gap), S415 (≠ Y383), M417 (= M385), M420 (≠ Y388)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
32% identity, 24% coverage: 322:424/431 of query aligns to 352:453/456 of 5oboA
- binding heme c: T360 (≠ Y330), C361 (= C331), C364 (= C334), H365 (= H335), P377 (≠ A347), P378 (= P348), L379 (= L349), S382 (≠ N352), F384 (≠ V355), I395 (≠ V366), N401 (≠ E372), G402 (vs. gap), S413 (≠ Y383), M415 (= M385), M418 (≠ Y388)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
32% identity, 24% coverage: 322:424/431 of query aligns to 351:452/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ Y330), C360 (= C331), C363 (= C334), H364 (= H335), P376 (≠ A347), P377 (= P348), L378 (= L349), F383 (≠ V355), N400 (≠ E372), G401 (vs. gap), Y410 (≠ A381), S412 (≠ Y383), M414 (= M385), M417 (≠ Y388)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
Query Sequence
>H281DRAFT_05401 FitnessBrowser__Burk376:H281DRAFT_05401
MKNTLKGFGAALCVALPFLAQTSPASAAASAADQALVQRGAYLAKAGDCAACHTAPKGKP
FAGGLPMNTPMGQIYTTNITPDAQTGIGSYTEQDFARAMREGVAKDGHNLYPAMPYPSYA
KVNDEDMKALYAFFMSGVAPVQQANRESDIKWPMNMRWPLKLWNMVFLEKGVYQNKPGKD
VAWNRGAYLIQGLGHCGSCHTPRGIAFQEKALDETGSAFLTGGLLDNWYATNLTGEHNVG
LGRWSDQDLQAFLKTGANRHASAFGSMTSVINNSTQNLNDGDIAAMTTYLKSLPAVGGNG
APPYKYDPQTTKVSLNRPANDAGARVYTAYCMHCHGVDGRGFAPMLAPLAGNPNVLEKDA
SSLINVTLNGTEDLVIGGIPAPYPMPKYAPVLNDQQIADVLTFVRAGWNNGAPAVTAADV
TKLRKSTQAAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory