Comparing H281DRAFT_05506 FitnessBrowser__Burk376:H281DRAFT_05506 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
7nutA Crystal structure of human amdhd2 in complex with zn and glcn6p (see paper)
37% identity, 87% coverage: 43:369/376 of query aligns to 60:400/401 of 7nutA
O34450 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Bacillus subtilis (strain 168) (see paper)
36% identity, 84% coverage: 37:352/376 of query aligns to 51:374/396 of O34450
2vhlB The three-dimensional structure of the n-acetylglucosamine-6- phosphate deacetylase from bacillus subtilis (see paper)
36% identity, 84% coverage: 37:352/376 of query aligns to 50:373/393 of 2vhlB
1o12A Crystal structure of n-acetylglucosamine-6-phosphate deacetylase (tm0814) from thermotoga maritima at 2.5 a resolution
34% identity, 87% coverage: 39:365/376 of query aligns to 39:360/363 of 1o12A
3iv8A N-acetylglucosamine-6-phosphate deacetylase from vibrio cholerae complexed with fructose 6-phosphate
33% identity, 86% coverage: 43:364/376 of query aligns to 54:376/379 of 3iv8A
O32445 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
33% identity, 86% coverage: 43:364/376 of query aligns to 53:375/378 of O32445
6fv4A The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
38% identity, 72% coverage: 36:306/376 of query aligns to 46:316/381 of 6fv4A
6fv4B The structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d267a mutant from mycobacterium smegmatis in complex with n-acetyl-d- glucosamine-6-phosphate (see paper)
38% identity, 72% coverage: 36:306/376 of query aligns to 46:316/385 of 6fv4B
6fv3D Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase from mycobacterium smegmatis. (see paper)
39% identity, 65% coverage: 36:280/376 of query aligns to 44:286/350 of 6fv3D
1yrrA Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
31% identity, 96% coverage: 4:365/376 of query aligns to 9:378/381 of 1yrrA
2p50A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
31% identity, 96% coverage: 4:365/376 of query aligns to 9:379/382 of 2p50A
P0AF18 N-acetylglucosamine-6-phosphate deacetylase; GlcNAc 6-P deacetylase; EC 3.5.1.25 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 96% coverage: 4:365/376 of query aligns to 9:379/382 of P0AF18
2p53A Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6- phosphate (see paper)
31% identity, 96% coverage: 4:365/376 of query aligns to 9:379/382 of 2p53A
2p50B Crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase liganded with zn (see paper)
30% identity, 96% coverage: 4:365/376 of query aligns to 9:353/356 of 2p50B
6jkuA Crystal structure of n-acetylglucosamine-6-phosphate deacetylase from pasteurella multocida (see paper)
28% identity, 96% coverage: 4:363/376 of query aligns to 16:381/385 of 6jkuA
1yrrB Crystal structure of the n-acetylglucosamine-6-phosphate deacetylase from escherichia coli k12 at 2.0 a resolution (see paper)
29% identity, 96% coverage: 4:365/376 of query aligns to 8:331/334 of 1yrrB
>H281DRAFT_05506 FitnessBrowser__Burk376:H281DRAFT_05506
MKNILTPKGWVLGRVVVDAAGLIARIEGSPVTSPLLAAGYVLPGFIDLHVHGGGGTDLMD
GETAACVVAKTHAEYGTTSFLATTMTAPEDDLRVATGHLGAAIRKPRGPGQSRILGVHLE
GPFLNANKRGSQPAHTRCAAPAELDELLNIAHVRLVTLAPEIEGQLAIIRKLVERGIRVQ
LGHSTGTYEQGLAALQCGATGFAHLFNAMSGMHHRDPGIVGVAFAHAEYAEMIPDLLHVH
PGAVKAAFRAIPKLYCITDSCSAVGMGEGEFTLGAQKVFRRRCESGVRLADGTLAASTLT
MDEALRNLVSLGMTIADASDRLSRFPADFLGLQDRGRLVPGAWGDYVALSQNLALEEVCI
EGEHVKPASTISVEQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory