Comparing H281DRAFT_05542 H281DRAFT_05542 tripartite ATP-independent transporter solute receptor, DctP family to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
28% identity, 78% coverage: 40:304/339 of query aligns to 9:272/303 of 4pddA
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
30% identity, 84% coverage: 54:338/339 of query aligns to 48:328/328 of Q0B2F6
Sites not aligning to the query:
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
28% identity, 81% coverage: 32:305/339 of query aligns to 1:273/301 of 4pdhA
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
31% identity, 80% coverage: 54:323/339 of query aligns to 22:288/301 of 4n17A
Sites not aligning to the query:
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
31% identity, 80% coverage: 54:323/339 of query aligns to 22:288/301 of 4n15A
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
28% identity, 78% coverage: 43:305/339 of query aligns to 15:276/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
28% identity, 78% coverage: 43:305/339 of query aligns to 14:275/303 of 4p9kA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
34% identity, 58% coverage: 54:251/339 of query aligns to 22:218/300 of 4n8yA
Sites not aligning to the query:
Q16BC9 Solute-binding protein RD1_1052 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
28% identity, 86% coverage: 6:297/339 of query aligns to 2:291/325 of Q16BC9
Q128M1 Solute-binding protein Bpro_3107 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
30% identity, 71% coverage: 54:294/339 of query aligns to 53:291/330 of Q128M1
Sites not aligning to the query:
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
30% identity, 71% coverage: 54:294/339 of query aligns to 23:261/302 of 4mijA
Sites not aligning to the query:
4mhfA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21 (see paper)
30% identity, 71% coverage: 54:294/339 of query aligns to 23:261/301 of 4mhfA
Sites not aligning to the query:
A3T0D1 Solute-binding protein NAS141_03721 from Sulfitobacter sp. (strain NAS-14.1) (see paper)
32% identity, 84% coverage: 9:294/339 of query aligns to 10:290/330 of A3T0D1
4pcdA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans och 114 (rd1_1052, target efi-510238) with bound l-galactonate (see paper)
29% identity, 76% coverage: 42:297/339 of query aligns to 14:267/300 of 4pcdA
4pc9A Crystal structure of a trap periplasmic solute binding protein from rosenbacter denitrificans och 114 (rd1_1052, target efi-510238) with bound d-mannonate (see paper)
29% identity, 76% coverage: 42:297/339 of query aligns to 14:267/300 of 4pc9A
Sites not aligning to the query:
4ovrA Crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d- galacturonate (see paper)
29% identity, 72% coverage: 52:295/339 of query aligns to 20:261/298 of 4ovrA
Sites not aligning to the query:
4ovpA Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1, target efi-510292, with bound alpha-d- manuronate (see paper)
31% identity, 75% coverage: 42:294/339 of query aligns to 18:270/308 of 4ovpA
4nx1A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1, target efi-510292, with bound alpha-d- taluronate (see paper)
31% identity, 75% coverage: 42:294/339 of query aligns to 18:270/308 of 4nx1A
4x04A Crystal structure of a trap periplasmic solute binding protein from citrobacter koseri (cko_04899, target efi-510094) with bound d- glucuronate
26% identity, 74% coverage: 52:303/339 of query aligns to 21:273/301 of 4x04A
Sites not aligning to the query:
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
27% identity, 83% coverage: 30:310/339 of query aligns to 4:281/310 of 7bcrA
>H281DRAFT_05542 H281DRAFT_05542 tripartite ATP-independent transporter solute receptor, DctP family
MQASRRHFLHAAGAAAATLVVPQVGRAAAPVQLRFSSTMTPDENSAHYIYYQRLQENLKK
SVGDQIRVDFFPNGQLGKEADVVQQVRLGSIDMMITGSSIWATALPEFALLDLGFLFDNW
AHVGKSVDHGVADIYDKLLQARTGCSVVGWGSHFSARSVYTKPAIKDIAQLKNVKLRVLP
TQAFIETFKLMGAIPTPIAFNEVYTAVQTGVVEGFEHDAASVLSNKLNEVVQNSWQTNHL
FSPCITVIGKRGLSKIPDAIKPQFCEAAHEASLYQRQAAATKGADAIASLKKAGMTFYPM
ADAERANIRKLMREKLWVPFTRSNPVTAPVLAAIDAARA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory