Comparing H281DRAFT_05661 FitnessBrowser__Burk376:H281DRAFT_05661 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
36% identity, 72% coverage: 15:105/127 of query aligns to 114:200/200 of 6j2lA
Sites not aligning to the query:
>H281DRAFT_05661 FitnessBrowser__Burk376:H281DRAFT_05661
MTQTTQVTPSTTDTLMRLAAIIDSRKGGDPDVSYVSRLFHKGDDAVLKKIGEEATEVVLA
AKDTRHGGATKALVGEVADLWFHCLVMLSHYDLSPADVLAELERREGMSGIEEKALRKSR
EREQNGD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory