Comparing H281DRAFT_05697 FitnessBrowser__Burk376:H281DRAFT_05697 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P0A8Y3 Alpha-D-glucose 1-phosphate phosphatase YihX; Alpha-D-glucose-1-P phosphatase; Alpha-D-glucose-1-phosphatase; Haloacid dehalogenase-like phosphatase 4; HAD4; EC 3.1.3.10 from Escherichia coli (strain K12)
31% identity, 62% coverage: 57:184/207 of query aligns to 51:178/199 of P0A8Y3
2b0cA The crystal structure of the putative phosphatase from escherichia coli
31% identity, 62% coverage: 57:184/207 of query aligns to 53:180/199 of 2b0cA
Sites not aligning to the query:
>H281DRAFT_05697 FitnessBrowser__Burk376:H281DRAFT_05697
MAIKAVVFDFGGVLIDWSPEYLYRQLIPDEAERRWFLTHVCSMDWVIRQDGGQPIVEATE
ELVARFPDHEALIRAFYERWHEMVAGVLEDGVAIMEKLEAAEVPLFGLTNWSAETFPYAW
EHYPVLRRFRDIVVSGRVGLVKPDPAIFAAMRERIDAQLPGVEPGELVFIDDNPKNAAAA
TALGWHGVHHTNAAQTEAKLRELGLPV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory