SitesBLAST
Comparing H281DRAFT_05724 FitnessBrowser__Burk376:H281DRAFT_05724 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3hazA Crystal structure of bifunctional proline utilization a (puta) protein (see paper)
26% identity, 71% coverage: 125:528/566 of query aligns to 568:957/983 of 3hazA
- active site: N652 (≠ T207), K675 (= K230), E752 (= E309), C786 (= C343), E878 (= E448)
- binding nicotinamide-adenine-dinucleotide: I648 (≠ L203), S649 (≠ G204), P650 (≠ C205), W651 (≠ C206), N652 (≠ T207), I657 (≠ N212), K675 (= K230), P676 (= P231), A677 (≠ L239), G708 (= G270), G711 (≠ V273), A712 (≠ Q274), T726 (= T288), G727 (= G289), S728 (= S290), V731 (vs. gap), I735 (vs. gap), E752 (= E309), T753 (≠ K310), C786 (= C343), E878 (= E448), F880 (= F450), F948 (≠ A519)
Sites not aligning to the query:
- active site: 960
- binding flavin-adenine dinucleotide: 272, 273, 306, 333, 335, 336, 337, 338, 339, 340, 358, 359, 360, 361, 364, 387, 388, 389, 390, 435, 460, 461
2eiwA Crystal analysis of delta1-pyrroline-5-carboxylate dehydrogenase from thermus thermophilus with bound l-proline
25% identity, 60% coverage: 195:535/566 of query aligns to 172:499/516 of 2eiwA
Sites not aligning to the query:
2j5nA 1-pyrroline-5-carboxylate dehydrogenase from thermus thermophirus with bound inhibitor glycine and NAD.
25% identity, 60% coverage: 195:535/566 of query aligns to 172:499/516 of 2j5nA
- active site: N184 (≠ T207), K207 (= K230), E288 (= E309), C322 (= C343), E417 (= E448), T497 (≠ A533)
- binding glycine: S323 (≠ T344), G477 (= G511), A478 (≠ G512), F485 (= F521)
- binding nicotinamide-adenine-dinucleotide: I180 (≠ L203), A181 (≠ G204), P182 (≠ C205), W183 (≠ C206), N184 (≠ T207), I189 (≠ N212), K207 (= K230), E210 (≠ P233), G240 (= G270), F258 (= F287), T259 (= T288), G260 (= G289), S261 (= S290), V264 (≠ N293), E288 (= E309), T289 (≠ K310), C322 (= C343), E417 (= E448), F419 (= F450)
2ej6A Crystal analysis of delta1-pyrroline-5-carboxylate dehydrogenase from thermus thermophilus with bound d-proline
25% identity, 60% coverage: 195:535/566 of query aligns to 172:499/516 of 2ej6A
Sites not aligning to the query:
2eitA Crystal analysis of delta1-pyrroline-5-carboxylate dehydrogenase from thermus thermophilus with bound l-alanine and NAD
25% identity, 60% coverage: 195:535/566 of query aligns to 172:499/516 of 2eitA
- active site: N184 (≠ T207), K207 (= K230), E288 (= E309), C322 (= C343), E417 (= E448), T497 (≠ A533)
- binding alanine: S323 (≠ T344), G477 (= G511), A478 (≠ G512), F485 (= F521)
- binding nicotinamide-adenine-dinucleotide: I180 (≠ L203), A181 (≠ G204), W183 (≠ C206), N184 (≠ T207), I189 (≠ N212), K207 (= K230), E210 (≠ P233), G240 (= G270), E241 (≠ A271), G244 (≠ Q274), F258 (= F287), T259 (= T288), G260 (= G289), S261 (= S290), V264 (≠ N293), E288 (= E309), G290 (≠ A311), C322 (= C343), E417 (= E448), F419 (= F450)
2eiiA Crystal analysis of delta1-pyrroline-5-carboxylate dehydrogenase from thermus thermophilus with bound l-valine and NAD.
25% identity, 60% coverage: 195:535/566 of query aligns to 172:499/516 of 2eiiA
- active site: N184 (≠ T207), K207 (= K230), E288 (= E309), C322 (= C343), E417 (= E448), T497 (≠ A533)
- binding nicotinamide-adenine-dinucleotide: I180 (≠ L203), A181 (≠ G204), P182 (≠ C205), W183 (≠ C206), N184 (≠ T207), I189 (≠ N212), K207 (= K230), E210 (≠ P233), G240 (= G270), E241 (≠ A271), G244 (≠ Q274), F258 (= F287), T259 (= T288), G260 (= G289), S261 (= S290), V264 (≠ N293), E288 (= E309), T289 (≠ K310), C322 (= C343), E417 (= E448), F419 (= F450)
- binding valine: F185 (= F208), S323 (≠ T344), G477 (= G511), A478 (≠ G512), F485 (= F521)
Sites not aligning to the query:
2ehuA Crystal analysis of 1-pyrroline-5-carboxylate dehydrogenase from thermus with bound NAD and inhibitor l-serine
25% identity, 60% coverage: 195:535/566 of query aligns to 172:499/516 of 2ehuA
- active site: N184 (≠ T207), K207 (= K230), E288 (= E309), C322 (= C343), E417 (= E448), T497 (≠ A533)
- binding nicotinamide-adenine-dinucleotide: I180 (≠ L203), A181 (≠ G204), P182 (≠ C205), W183 (≠ C206), N184 (≠ T207), I189 (≠ N212), K207 (= K230), E210 (≠ P233), G240 (= G270), F258 (= F287), T259 (= T288), G260 (= G289), S261 (= S290), V264 (≠ N293), E288 (= E309), T289 (≠ K310), C322 (= C343), E417 (= E448), F419 (= F450)
- binding serine: F185 (= F208), C322 (= C343), S323 (≠ T344), G477 (= G511), A478 (≠ G512), F485 (= F521)
2ehqA Crystal analysis of 1-pyrroline-5-carboxylate dehydrogenase from thermus with bound NADP (see paper)
25% identity, 60% coverage: 195:535/566 of query aligns to 172:499/516 of 2ehqA
- active site: N184 (≠ T207), K207 (= K230), E288 (= E309), C322 (= C343), E417 (= E448), T497 (≠ A533)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I180 (≠ L203), A181 (≠ G204), P182 (≠ C205), W183 (≠ C206), N184 (≠ T207), I189 (≠ N212), K207 (= K230), A209 (≠ H232), E210 (≠ P233), V239 (≠ D269), G240 (= G270), E241 (≠ A271), F258 (= F287), T259 (= T288), G260 (= G289), S261 (= S290), V264 (≠ N293), E288 (= E309), T289 (≠ K310), C322 (= C343), E417 (= E448), F419 (= F450)
2bhqA Crystal analysis of 1-pyrroline-5-carboxylate dehydrogenase from thermus with bound product glutamate. (see paper)
25% identity, 60% coverage: 195:535/566 of query aligns to 172:499/516 of 2bhqA
- active site: N184 (≠ T207), K207 (= K230), E288 (= E309), C322 (= C343), E417 (= E448), T497 (≠ A533)
- binding glutamic acid: F185 (= F208), I189 (≠ N212), K321 (≠ M342), C322 (= C343), S323 (≠ T344), T476 (= T510), G477 (= G511), A478 (≠ G512), F485 (= F521)
2bhpA Crystal analysis of 1-pyrroline-5-carboxylate dehydrogenase from thermus with bound NAD. (see paper)
25% identity, 60% coverage: 195:535/566 of query aligns to 172:499/516 of 2bhpA
- active site: N184 (≠ T207), K207 (= K230), E288 (= E309), C322 (= C343), E417 (= E448), T497 (≠ A533)
- binding nicotinamide-adenine-dinucleotide: I180 (≠ L203), A181 (≠ G204), P182 (≠ C205), W183 (≠ C206), N184 (≠ T207), I189 (≠ N212), K207 (= K230), E210 (≠ P233), G240 (= G270), E241 (≠ A271), F258 (= F287), T259 (= T288), G260 (= G289), S261 (= S290), V264 (≠ N293), E288 (= E309), T289 (≠ K310), C322 (= C343), E417 (= E448), F419 (= F450)
1eyyA Crystal structure of the NADP+ dependent aldehyde dehydrogenase from vibrio harveyi. (see paper)
27% identity, 51% coverage: 198:488/566 of query aligns to 134:410/504 of 1eyyA
6j76A Structure of 3,6-anhydro-l-galactose dehydrogenase in complex with nap (see paper)
26% identity, 68% coverage: 87:469/566 of query aligns to 39:402/477 of 6j76A
- active site: N148 (≠ T207), E246 (= E309), C280 (= C343)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I144 (≠ L203), T145 (≠ G204), A146 (≠ C205), W147 (≠ C206), N148 (≠ T207), K171 (= K230), T173 (≠ H232), S174 (≠ P233), G204 (≠ D269), G208 (≠ V273), T223 (= T288), G224 (= G289), S225 (= S290), A228 (≠ N293), S231 (≠ W296), I232 (≠ L297), E246 (= E309), L247 (≠ K310), C280 (= C343), E381 (= E448), F383 (= F450)
Sites not aligning to the query:
4o6rA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
29% identity, 51% coverage: 211:500/566 of query aligns to 149:429/489 of 4o6rA
- active site: N150 (= N212), K173 (= K230), E248 (≠ Y307), C282 (= C343), E383 (= E448)
- binding adenosine monophosphate: K173 (= K230), G206 (= G270), G210 (vs. gap), Q211 (= Q274), F224 (= F287), G226 (= G289), S227 (= S290), T230 (≠ N293), R233 (≠ W296)
Sites not aligning to the query:
4jz6A Crystal structure of a salicylaldehyde dehydrogenase from pseudomonas putida g7 complexed with salicylaldehyde (see paper)
23% identity, 55% coverage: 211:520/566 of query aligns to 149:445/484 of 4jz6A
- active site: N150 (= N212), K173 (= K230), E251 (= E309), C285 (= C343), E380 (= E448)
- binding salicylaldehyde: G151 (= G213), V154 (≠ G216), R247 (≠ Q305), C248 (≠ V306), I284 (≠ M342), C285 (= C343), M286 (≠ T344)
Sites not aligning to the query:
4nmfB Crystal structure of proline utilization a (puta) from geobacter sulfurreducens pca inactivated by n-propargylglycine and complexed with menadione bisulfite (see paper)
24% identity, 60% coverage: 192:528/566 of query aligns to 616:942/979 of 4nmfB
Sites not aligning to the query:
- active site: 945
- binding (2R)-2-methyl-1,4-dioxo-1,2,3,4-tetrahydronaphthalene-2-sulfonic acid: 184, 290, 387, 399, 402, 403
- binding (2S)-2-methyl-1,4-dioxo-1,2,3,4-tetrahydronaphthalene-2-sulfonic acid: 184, 366, 399, 402
- binding N-propargylglycine-modified flavin adenine dinucleotide: 184, 225, 226, 255, 257, 284, 286, 287, 288, 289, 291, 308, 309, 310, 311, 314, 337, 338, 339, 340, 364, 366, 387, 406, 411, 412, 413
4nmfA Crystal structure of proline utilization a (puta) from geobacter sulfurreducens pca inactivated by n-propargylglycine and complexed with menadione bisulfite (see paper)
24% identity, 60% coverage: 192:528/566 of query aligns to 610:936/973 of 4nmfA
Sites not aligning to the query:
- active site: 939
- binding (2R)-2-methyl-1,4-dioxo-1,2,3,4-tetrahydronaphthalene-2-sulfonic acid: 181, 287, 384, 396, 399, 400
- binding N-propargylglycine-modified flavin adenine dinucleotide: 181, 222, 223, 252, 254, 281, 283, 284, 285, 286, 288, 305, 306, 307, 308, 311, 334, 335, 336, 337, 361, 362, 363, 384, 403, 408, 410
4nmaA Crystal structure of proline utilization a (puta) from geobacter sulfurreducens pca in complex with l-tetrahydro-2-furoic acid (see paper)
24% identity, 60% coverage: 192:528/566 of query aligns to 614:940/977 of 4nmaA
Sites not aligning to the query:
- active site: 943
- binding flavin-adenine dinucleotide: 226, 227, 258, 285, 287, 288, 289, 290, 291, 292, 309, 310, 311, 312, 315, 338, 339, 340, 341, 365, 367, 407, 413, 414
- binding tetrahydrofuran-2-carboxylic acid: 185, 388, 400, 403, 404
4nmcA Crystal structure of oxidized proline utilization a (puta) from geobacter sulfurreducens pca complexed with zwittergent 3-12 (see paper)
24% identity, 60% coverage: 192:530/566 of query aligns to 579:907/941 of 4nmcA
Sites not aligning to the query:
- active site: 908
- binding flavin-adenine dinucleotide: 215, 216, 245, 247, 274, 276, 277, 278, 279, 281, 298, 299, 300, 301, 304, 327, 328, 329, 330, 356, 377
4nmdA Crystal structure of proline utilization a (puta) from geobacter sulfurreducens pca reduced with dithionite (see paper)
24% identity, 60% coverage: 192:528/566 of query aligns to 616:942/979 of 4nmdA
Sites not aligning to the query:
- active site: 945
- binding dihydroflavine-adenine dinucleotide: 226, 227, 256, 258, 285, 287, 288, 289, 290, 292, 309, 310, 311, 312, 315, 338, 339, 340, 341, 365, 366, 367, 388, 414
7na0A Structure of geobacter sulfurreducens proline utilization a (puta) variant a206w (see paper)
24% identity, 60% coverage: 192:528/566 of query aligns to 617:943/981 of 7na0A
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 226, 227, 256, 258, 285, 287, 288, 289, 290, 291, 292, 309, 310, 311, 312, 315, 338, 339, 340, 341, 367, 388, 407, 413, 414
Query Sequence
>H281DRAFT_05724 FitnessBrowser__Burk376:H281DRAFT_05724
MTHPLFTKHEDTLQKALAAVETRGYWSPFVEMPSPKVYGETANADGEAAFKAHLNATFEL
DQPSTGETVGTEVSPFGFPLGIRYPKSDPDALLAAAAEAQRDWRAAGPQAWIGVSLEILA
RLNRASFEIGYSVMHTTGQAFMMAFQAGGPHAQDRALEAVVYAWDQLRRIPADAHWEKPQ
GKNPPLAMQKRYTIVPRGTALVLGCCTFPTWNGYPGLFADLATGNAVIVKPHPGAILPLA
VTVRIARDVLREAGFDPNVVTLLATEPNDGAIVQSLAVRPEIKLIDFTGSTQNGTWLERN
AHQAQVYTEKAGVNQIVIDSADDIKAVARNIAFSLALYSGQMCTAPQNIYVPRDGIQTAD
GTLSFDEVAQAIAGAVQKLVADPARAVELLGAIQNEGVAQRVDEAATLGRVLVESQALEH
PAFAGARVRTPLVLQLDAATDGEQFTKEWFGPISFVIATDSTAHSLDLAGTIAAEHGALT
LSVYSTDEAVLDQAHEASIRGGVALSINLTGGVFVNQSAAFSDFHGTGANPAANAALADA
AFVANRFRVIQSRVHVEPKAAPAVAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory