Comparing H281DRAFT_05805 FitnessBrowser__Burk376:H281DRAFT_05805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
40% identity, 96% coverage: 4:324/334 of query aligns to 3:330/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
39% identity, 88% coverage: 19:311/334 of query aligns to 23:315/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
39% identity, 88% coverage: 19:311/334 of query aligns to 22:304/310 of 4fwiB
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
35% identity, 75% coverage: 4:254/334 of query aligns to 3:247/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
35% identity, 75% coverage: 4:254/334 of query aligns to 3:247/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
35% identity, 75% coverage: 4:254/334 of query aligns to 3:247/250 of 7z16I
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
35% identity, 75% coverage: 4:254/334 of query aligns to 2:239/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
34% identity, 75% coverage: 3:254/334 of query aligns to 2:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
34% identity, 75% coverage: 3:254/334 of query aligns to 2:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
34% identity, 75% coverage: 3:254/334 of query aligns to 2:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
34% identity, 75% coverage: 3:254/334 of query aligns to 2:241/242 of 2oljA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 72% coverage: 17:256/334 of query aligns to 18:251/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 72% coverage: 17:256/334 of query aligns to 19:252/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 72% coverage: 17:256/334 of query aligns to 19:252/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 72% coverage: 17:256/334 of query aligns to 19:252/344 of 6cvlD
Sites not aligning to the query:
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
36% identity, 69% coverage: 4:232/334 of query aligns to 4:218/218 of 7w78A
7w79A Heme exporter hrtba in complex with mn-amppnp (see paper)
36% identity, 68% coverage: 4:231/334 of query aligns to 4:209/216 of 7w79A
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
36% identity, 65% coverage: 19:235/334 of query aligns to 20:229/232 of 1f3oA
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
33% identity, 66% coverage: 4:223/334 of query aligns to 3:215/226 of 5xu1B
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
36% identity, 65% coverage: 19:235/334 of query aligns to 20:229/230 of 1l2tA
Sites not aligning to the query:
>H281DRAFT_05805 FitnessBrowser__Burk376:H281DRAFT_05805
MDNLLTIRNLAVNFNGLPAVDRINLDVAPGEVLGVVGESGSGKSVTMMALMGLIDAPGKV
TADEITFNGRDLLKASAKERRKIIGKDIAMVFQDALTSLNPSYTVGYQIKEVLKLHEGLR
GAALDKRALELLDQVGIPDAKSRIGAFPHQMSGGMNQRVMIAMAIACNPKLLIADEPTTA
LDVTIQAQIMELLMRLQKERGMALVLISHDLAVVSEVAQRVAVMYAGEVIETNKVPDIFA
APHHPYTEALLAAIPEHNVGAVRLAALPGMVPGRDDRPKGCLFAPRCKYMVDDCNRGRPA
LAPMQGHAEVARVRCIKPLNLSGDANVHTHGGAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory