Comparing H281DRAFT_05854 FitnessBrowser__Burk376:H281DRAFT_05854 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
28% identity, 67% coverage: 11:254/362 of query aligns to 159:400/403 of 3ozwA
Sites not aligning to the query:
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
28% identity, 67% coverage: 11:254/362 of query aligns to 159:400/403 of 3ozvA
Sites not aligning to the query:
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
28% identity, 67% coverage: 11:254/362 of query aligns to 159:400/403 of 3ozuA
Sites not aligning to the query:
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
28% identity, 67% coverage: 11:254/362 of query aligns to 159:400/403 of P39662
Sites not aligning to the query:
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
28% identity, 67% coverage: 11:254/362 of query aligns to 159:400/403 of 1cqxA
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
30% identity, 67% coverage: 7:250/362 of query aligns to 95:329/333 of 5ogxA
Sites not aligning to the query:
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
30% identity, 67% coverage: 7:250/362 of query aligns to 96:330/334 of P0DPQ8
Sites not aligning to the query:
7ylrA Structure of a bacteria protein
29% identity, 86% coverage: 33:344/362 of query aligns to 31:311/326 of 7ylrA
Sites not aligning to the query:
Q9ZNT1 NADH--cytochrome b5 reductase 1; EC 1.6.2.2 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
32% identity, 53% coverage: 52:243/362 of query aligns to 93:276/281 of Q9ZNT1
Sites not aligning to the query:
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
26% identity, 59% coverage: 37:250/362 of query aligns to 43:244/250 of 1tvcA
Sites not aligning to the query:
Q8IED5 Ferredoxin, apicoplast from Plasmodium falciparum (isolate 3D7) (see paper)
43% identity, 19% coverage: 293:361/362 of query aligns to 120:188/194 of Q8IED5
1iueA Crystal structure analysis of ferredoxin from plasmodium falciparum
43% identity, 19% coverage: 293:361/362 of query aligns to 24:92/98 of 1iueA
4zhoA The crystal structure of arabidopsis ferredoxin 2 with 2fe-2s cluster (see paper)
37% identity, 26% coverage: 268:362/362 of query aligns to 9:93/97 of 4zhoA
P27787 Ferredoxin-1, chloroplastic; Ferredoxin I; Fd I from Zea mays (Maize) (see 2 papers)
39% identity, 22% coverage: 283:362/362 of query aligns to 67:145/150 of P27787
Sites not aligning to the query:
7aktA Crpetf variant - a39g_a41v
42% identity, 19% coverage: 293:361/362 of query aligns to 35:103/107 of 7aktA
3ab5A Crystal structure of the 2fe 2s ferredoxin from cyanidioschyzon merolae
41% identity, 19% coverage: 293:361/362 of query aligns to 25:93/97 of 3ab5A
6khi1 Supercomplex for cylic electron transport in cyanobacteria (see paper)
38% identity, 23% coverage: 278:362/362 of query aligns to 12:95/98 of 6khi1
7fixR1 Photosystem I reaction center subunit PsaK (see paper)
38% identity, 23% coverage: 278:362/362 of query aligns to 11:94/97 of 7fixR1
P49050 Nitrate reductase [NADPH]; NR; EC 1.7.1.3 from Pichia angusta (Yeast) (Hansenula polymorpha) (see paper)
28% identity, 45% coverage: 83:245/362 of query aligns to 685:856/859 of P49050
Sites not aligning to the query:
1gaqB Crystal structure of the complex between ferredoxin and ferredoxin- NADP+ reductase (see paper)
39% identity, 22% coverage: 283:361/362 of query aligns to 15:92/98 of 1gaqB
>H281DRAFT_05854 FitnessBrowser__Burk376:H281DRAFT_05854
MATPQFHPLRIREVRPETADAVSVAFEVPVELRELYRFTQGQFVTLKTHIDGEETRRSYS
ICVGVTDYDRDGELRIGIKRVRGGRFSNFAFDTLQPGHTIDVMTPDGRFFTHLNADHGQQ
YVAFAGGSGITPVLAIIKTTLELEPRSTFTLIYGNRSVDQIMFAEELEDLKNRFMNRFVL
YHVLSDDLQDVELFNGVLDQQKCESFLDSLVPADSIDEAFICGPAPMMDAAEAALKAAGV
PSEKVHVERFGSPLPQAGVPPVEITEDTPAADLEIVLDGKRRKLRLPYQGVSVLDVGLRA
GLALPYACKGGVCCTCRAKVVEGEVRMEKNYTLEEHEIRDGFVLTCQCHPVSDRVVVSYD
ER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory