SitesBLAST
Comparing H281DRAFT_05881 FitnessBrowser__Burk376:H281DRAFT_05881 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
29% identity, 59% coverage: 166:411/414 of query aligns to 117:363/369 of S5FMM4
- S202 (≠ L251) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ L381) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L391) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
29% identity, 57% coverage: 177:411/414 of query aligns to 128:363/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (≠ A223), V174 (≠ A224), S202 (≠ L251), G203 (= G252), W205 (= W254), F209 (≠ V258), G300 (= G349), R302 (= R351), H327 (= H376), F328 (≠ N377), R329 (≠ H378), N330 (≠ H379), G331 (= G380), I332 (≠ L381)
- binding glycolic acid: Y246 (= Y296), R302 (= R351), R329 (≠ H378)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
29% identity, 57% coverage: 177:411/414 of query aligns to 128:363/369 of O31616
- V174 (≠ A224) binding
- H244 (≠ Q294) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R351) binding
- 327:333 (vs. 376:382, 29% identical) binding
- R329 (≠ H378) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
29% identity, 57% coverage: 177:411/414 of query aligns to 128:363/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (= Y296), R302 (= R351), R329 (≠ H378)
- binding flavin-adenine dinucleotide: V174 (≠ A224), S202 (≠ L251), G203 (= G252), W205 (= W254), F209 (≠ V258), G300 (= G349), R302 (= R351), H327 (= H376), R329 (≠ H378), N330 (≠ H379), G331 (= G380), I332 (≠ L381)
- binding phosphate ion: R254 (= R304)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
24% identity, 95% coverage: 3:397/414 of query aligns to 2:346/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ L8), G8 (= G9), G10 (= G11), V11 (≠ I12), I12 (≠ V13), V30 (= V31), E31 (≠ D32), K32 (≠ R33), E38 (= E39), A39 (≠ T40), S40 (= S41), A43 (≠ N44), G45 (= G46), L46 (= L47), V171 (vs. gap), G200 (≠ L251), G201 (= G252), W203 (= W254), G298 (= G349), R300 (= R351), P301 (= P352), Y326 (≠ N377), R327 (≠ H378), N328 (≠ H379), G329 (= G380), I330 (≠ L381)
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
26% identity, 99% coverage: 5:413/414 of query aligns to 3:364/370 of 6pxsA
- binding flavin-adenine dinucleotide: G7 (= G9), G9 (= G11), I10 (= I12), D30 (= D32), N32 (≠ R34), H33 (≠ A35), K36 (≠ E38), A37 (≠ E39), T38 (= T40), A40 (≠ F42), G41 (= G43), A42 (= A45), G43 (= G46), V44 (≠ L47), Y174 (≠ A223), A203 (≠ L251), W206 (= W254), I210 (≠ V258), Y250 (≠ L305), G305 (= G349), R307 (= R351), G333 (≠ N377), A334 (≠ H378), S335 (≠ H379), G336 (= G380), L337 (= L381), T338 (= T382)
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
29% identity, 43% coverage: 234:411/414 of query aligns to 191:369/377 of Q5L2C2
- R309 (= R351) binding
- 334:340 (vs. 376:382, 29% identical) binding
- R336 (≠ H378) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 180 binding
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
29% identity, 43% coverage: 234:411/414 of query aligns to 189:367/368 of 4yshB
- active site: I262 (≠ L307), L283 (≠ Q324), G305 (= G349), N335 (≠ H379), L338 (≠ T382)
- binding flavin-adenine dinucleotide: S206 (≠ L251), W209 (= W254), R307 (= R351), H332 (= H376), R334 (≠ H378), N335 (≠ H379), G336 (= G380), I337 (≠ L381), L338 (≠ T382)
- binding glycine: G249 (≠ Q294), Y251 (= Y296), Y251 (= Y296), A264 (vs. gap), R307 (= R351), R334 (≠ H378), R334 (≠ H378)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48, 178
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
29% identity, 43% coverage: 234:411/414 of query aligns to 189:367/370 of 4yshA
- active site: I262 (≠ L307), L283 (≠ Q324), G305 (= G349), N335 (≠ H379), L338 (≠ T382)
- binding flavin-adenine dinucleotide: S206 (≠ L251), G207 (= G252), W209 (= W254), R307 (= R351), H332 (= H376), R334 (≠ H378), N335 (≠ H379), G336 (= G380), I337 (≠ L381)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48, 178
7exsA Thermomicrobium roseum sarcosine oxidase mutant - s320r (see paper)
25% identity, 69% coverage: 108:394/414 of query aligns to 57:352/372 of 7exsA
- binding flavin-adenine dinucleotide: V169 (≠ L219), T196 (≠ A250), A197 (≠ L251), G198 (= G252), W200 (= W254), Y248 (≠ V297), C307 (≠ G349), L308 (= L350), Y309 (≠ R351), G336 (≠ H378), H337 (= H379), G338 (= G380), F339 (≠ L381), K340 (≠ T382)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 30, 31, 36, 39, 40, 41, 46, 47
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
35% identity, 16% coverage: 347:411/414 of query aligns to 303:370/374 of 1y56B
Sites not aligning to the query:
- active site: 44, 47, 48, 224, 239
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 33, 34, 35, 42, 43, 45, 46, 47, 49, 170, 171, 200, 201, 203
- binding flavin mononucleotide: 44, 45, 260, 301
Query Sequence
>H281DRAFT_05881 FitnessBrowser__Burk376:H281DRAFT_05881
MDFDVIVLGGGIVGVSCALHLQDRGRRVALVDRRAPGEETSFGNAGLIERAAVVPYGFPR
DLRTLLRFAKNRSTDLYWDYRAVPHFATWLARFWWESSAERLMAAARDMLPLIERSVTEH
ERLIKRAELQHLVRATGWIDAYRTPARLAREAAAAEATAGSYGLRVSVLDGGTLAAREPG
AVGGFCGALHWQDPMSVVNPGELTKGYARLFEASGGVVLTGDAATLSGRAGAWTVQTTSG
RISAKEAVVALGPWSDCVFAPLGYRIPLRVKRGYHMHYRPTRPMLSMPFVDAEQGYVVAP
MEGRLRLTTGVEIARRDAEPTGIQLGRAERFARPSFGLGERLDDSPWLGLRPCTPDMRPV
IGRAPRHTGLWFAFGHNHHGLTLGPATGRLLAEMMTGAPTFADPHPFRVERFSR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory