Comparing H281DRAFT_05949 FitnessBrowser__Burk376:H281DRAFT_05949 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3e5zA X-ray structure of the putative gluconolactonase in protein family pf08450. Northeast structural genomics consortium target drr130.
38% identity, 96% coverage: 11:299/302 of query aligns to 7:287/290 of 3e5zA
3dr2A Structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways (see paper)
39% identity, 91% coverage: 20:293/302 of query aligns to 31:296/299 of 3dr2A
Q9A9Z1 D-xylonolactone lactonase; Xylono-1,5-lactonase; EC 3.1.1.110 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
29% identity, 85% coverage: 30:285/302 of query aligns to 7:251/289 of Q9A9Z1
7pldB Caulobacter crescentus xylonolactonase with (r)-4-hydroxy-2- pyrrolidone (see paper)
29% identity, 85% coverage: 30:285/302 of query aligns to 7:251/289 of 7pldB
7plbB Caulobacter crescentus xylonolactonase with d-xylose (see paper)
29% identity, 85% coverage: 30:285/302 of query aligns to 7:251/289 of 7plbB
7rizA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound 2-hydroxyquinoline (see paper)
27% identity, 58% coverage: 116:289/302 of query aligns to 116:286/306 of 7rizA
Sites not aligning to the query:
8dk0A Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma- valerolactone (see paper)
24% identity, 87% coverage: 26:287/302 of query aligns to 6:271/293 of 8dk0A
8djzA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound product (see paper)
24% identity, 87% coverage: 26:287/302 of query aligns to 6:271/293 of 8djzA
8djfA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound tetrahedral intermediate (see paper)
24% identity, 87% coverage: 26:287/302 of query aligns to 6:271/293 of 8djfA
7risA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound phosphate (see paper)
24% identity, 87% coverage: 26:289/302 of query aligns to 4:273/293 of 7risA
5gx1A Luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 1.1 mgy (1st measurement) (see paper)
30% identity, 41% coverage: 163:286/302 of query aligns to 144:270/307 of 5gx1A
Sites not aligning to the query:
5d9bA Luciferin-regenerating enzyme solved by siras using xfel (refined against native data) (see paper)
30% identity, 41% coverage: 163:286/302 of query aligns to 144:270/307 of 5d9bA
Sites not aligning to the query:
4gnaA Mouse smp30/gnl-xylitol complex (see paper)
25% identity, 84% coverage: 34:287/302 of query aligns to 16:261/297 of 4gnaA
4gn9A Mouse smp30/gnl-glucose complex (see paper)
25% identity, 84% coverage: 34:287/302 of query aligns to 16:261/297 of 4gn9A
4gn8A Mouse smp30/gnl-1,5-ag complex (see paper)
25% identity, 84% coverage: 34:287/302 of query aligns to 16:261/297 of 4gn8A
Sites not aligning to the query:
4gn7A Mouse smp30/gnl (see paper)
25% identity, 84% coverage: 34:287/302 of query aligns to 16:261/297 of 4gn7A
7zqgA Crystal structure of pizza6-ksh-tsh with silicotungstic acid (sta) polyoxometalate
28% identity, 66% coverage: 46:245/302 of query aligns to 65:236/247 of 7zqgA
Sites not aligning to the query:
Q15493 Regucalcin; RC; Gluconolactonase; GNL; Senescence marker protein 30; SMP-30; EC 3.1.1.17 from Homo sapiens (Human) (see 2 papers)
23% identity, 86% coverage: 26:286/302 of query aligns to 10:262/299 of Q15493
3g4hA Crystal structure of human senescence marker protein-30 (zinc bound) (see paper)
23% identity, 86% coverage: 26:286/302 of query aligns to 8:260/297 of 3g4hA
4gncA Human smp30/gnl-1,5-ag complex (see paper)
23% identity, 86% coverage: 26:286/302 of query aligns to 9:261/298 of 4gncA
Sites not aligning to the query:
>H281DRAFT_05949 FitnessBrowser__Burk376:H281DRAFT_05949
MKNNEYEVHDPRFRLLLQPNASMDKLTGECLWAEGPVYFPATDLLIWSDIPNNRMLRWAP
GMGVGVYRGPSNYSNGNTRDREGRLVSCEHGERRVTRTEHDGSITVIASHFEGKRLNSPN
DVIVDSEGAIWFTDPDYGIISDYEGYRSDSEIGRCNVYRVSPGDTQVRLVSDDFVKPNGL
AFSPDESKLYIADSAASHDDNAPRHIRVFDVASNGALRNGRVFVEMQSGVPDGMRVDEHG
NVWTSAEDGVHCYAPDGTLLGKILIPEVVANLTFGGPRRNRLFITATSSVYALHVGVRGA
AR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory