SitesBLAST
Comparing H281DRAFT_05961 FitnessBrowser__Burk376:H281DRAFT_05961 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
38% identity, 95% coverage: 11:308/315 of query aligns to 3:303/304 of 1wwkA
- active site: S96 (≠ N104), R230 (= R235), D254 (= D259), E259 (= E264), H278 (= H283)
- binding nicotinamide-adenine-dinucleotide: V100 (= V108), G146 (= G154), F147 (≠ L155), G148 (= G156), R149 (≠ A157), I150 (= I158), Y168 (≠ F176), D169 (= D177), P170 (= P178), V201 (≠ C206), P202 (= P207), T207 (≠ N212), T228 (= T233), S229 (≠ A234), D254 (= D259), H278 (= H283), G280 (= G285)
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
41% identity, 94% coverage: 8:303/315 of query aligns to 2:297/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
41% identity, 94% coverage: 8:303/315 of query aligns to 3:298/525 of 3ddnB
7dkmA Phgdh covalently linked to oridonin (see paper)
37% identity, 81% coverage: 53:308/315 of query aligns to 46:304/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ S80), A102 (≠ V108), G148 (= G154), R151 (≠ A157), I152 (= I158), Y170 (≠ F176), D171 (= D177), P172 (= P178), I173 (≠ Y179), H202 (= H205), T203 (≠ C206), P204 (= P207), T209 (≠ N212), C230 (≠ T233), A231 (= A234), R232 (= R235), H279 (= H283), G281 (= G285)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ K297)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
37% identity, 81% coverage: 53:307/315 of query aligns to 42:299/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G156), I148 (= I158), Y166 (≠ F176), D167 (= D177), P168 (= P178), I169 (≠ Y179), I170 (≠ A180), H198 (= H205), T199 (≠ C206), L208 (≠ M215), R228 (= R235)
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
37% identity, 81% coverage: 53:308/315 of query aligns to 46:304/305 of 6plfA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
37% identity, 81% coverage: 53:308/315 of query aligns to 45:303/303 of 6plgA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
37% identity, 81% coverage: 53:307/315 of query aligns to 45:302/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V153), G147 (= G154), L148 (= L155), G149 (= G156), R150 (≠ A157), I151 (= I158), G152 (= G159), D170 (= D177), H201 (= H205), T202 (≠ C206), P203 (= P207)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
37% identity, 81% coverage: 53:307/315 of query aligns to 45:302/302 of 6rihA
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
37% identity, 81% coverage: 54:308/315 of query aligns to 51:308/533 of O43175
- T78 (≠ S80) binding
- R135 (≠ K137) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ AI 157:158) binding
- D175 (= D177) binding
- T207 (≠ C206) binding
- CAR 234:236 (≠ TAR 233:235) binding
- D260 (= D259) binding
- V261 (≠ S260) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIGG 283:286) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
37% identity, 78% coverage: 53:297/315 of query aligns to 44:291/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N104), A100 (≠ V108), R149 (≠ A157), I150 (= I158), Y168 (≠ F176), D169 (= D177), P170 (= P178), I171 (≠ Y179), H200 (= H205), T201 (≠ C206), P202 (= P207), T207 (≠ N212), C228 (≠ T233), A229 (= A234), R230 (= R235), H277 (= H283), G279 (= G285)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
37% identity, 78% coverage: 53:297/315 of query aligns to 44:291/297 of 6rj3A
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
37% identity, 78% coverage: 53:297/315 of query aligns to 45:292/301 of 6rj5A
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
37% identity, 78% coverage: 53:297/315 of query aligns to 40:283/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ A157), Y160 (≠ F176), D161 (= D177), P162 (= P178), I164 (≠ A180), L179 (= L192), T193 (≠ C206), P194 (= P207), S198 (≠ E211), L202 (≠ M215)
1hl3A Ctbp/bars in ternary complex with NAD(h) and pidlskk peptide (see paper)
37% identity, 76% coverage: 66:303/315 of query aligns to 61:310/331 of 1hl3A
- active site: S99 (≠ N104), R241 (= R235), D265 (= D259), E270 (= E264), H290 (= H283)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V108), G158 (= G156), R159 (≠ A157), V160 (≠ I158), D179 (= D177), Y181 (= Y179), H211 (= H205), C212 (= C206), G213 (≠ P207), N218 (= N212), T239 (= T233), A240 (= A234), R241 (= R235), D265 (= D259), H290 (= H283)
Sites not aligning to the query:
1hkuA Ctbp/bars: a dual-function protein involved in transcription corepression and golgi membrane fission (see paper)
37% identity, 76% coverage: 66:303/315 of query aligns to 61:310/331 of 1hkuA
- active site: S99 (≠ N104), R241 (= R235), D265 (= D259), E270 (= E264), H290 (= H283)
- binding nicotinamide-adenine-dinucleotide: S75 (= S80), T103 (≠ V108), G156 (= G154), G158 (= G156), R159 (≠ A157), V160 (≠ I158), Y178 (≠ F176), D179 (= D177), P180 (= P178), Y181 (= Y179), C212 (= C206), N218 (= N212), T239 (= T233), A240 (= A234), R241 (= R235), H290 (= H283), W293 (≠ G286)
Sites not aligning to the query:
4u6sA Ctbp1 in complex with substrate phenylpyruvate (see paper)
38% identity, 74% coverage: 72:303/315 of query aligns to 67:310/328 of 4u6sA
- active site: S99 (≠ N104), R241 (= R235), D265 (= D259), E270 (= E264), H290 (= H283)
- binding nicotinamide-adenine-dinucleotide: T103 (≠ V108), G156 (= G154), G158 (= G156), R159 (≠ A157), V160 (≠ I158), Y178 (≠ F176), D179 (= D177), P180 (= P178), Y181 (= Y179), H211 (= H205), C212 (= C206), G213 (≠ P207), N218 (= N212), T239 (= T233), A240 (= A234), R241 (= R235), H290 (= H283), W293 (≠ G286)
- binding 3-phenylpyruvic acid: I73 (≠ H78), G74 (= G79), S75 (= S80), G76 (= G81), R241 (= R235), W293 (≠ G286), M302 (= M295)
Sites not aligning to the query:
4u6qA Ctbp1 bound to inhibitor 2-(hydroxyimino)-3-phenylpropanoic acid (see paper)
38% identity, 74% coverage: 72:303/315 of query aligns to 67:310/328 of 4u6qA
- active site: S99 (≠ N104), R241 (= R235), D265 (= D259), E270 (= E264), H290 (= H283)
- binding (2E)-2-(hydroxyimino)-3-phenylpropanoic acid: I73 (≠ H78), G74 (= G79), S75 (= S80), G76 (= G81), R241 (= R235), H290 (= H283), W293 (≠ G286), M302 (= M295)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S75 (= S80), T103 (≠ V108), G156 (= G154), R159 (≠ A157), V160 (≠ I158), Y178 (≠ F176), D179 (= D177), P180 (= P178), Y181 (= Y179), H211 (= H205), C212 (= C206), G213 (≠ P207), N218 (= N212), T239 (= T233), A240 (= A234), R241 (= R235), H290 (= H283), W293 (≠ G286)
Sites not aligning to the query:
6cdfA Human ctbp1 (28-378) (see paper)
38% identity, 74% coverage: 72:303/315 of query aligns to 68:311/333 of 6cdfA
- binding 1,4-dihydronicotinamide adenine dinucleotide: T104 (≠ V108), G157 (= G154), R160 (≠ A157), V161 (≠ I158), Y179 (≠ F176), D180 (= D177), P181 (= P178), Y182 (= Y179), H212 (= H205), C213 (= C206), N219 (= N212), T240 (= T233), A241 (= A234), R242 (= R235), H291 (= H283), W294 (≠ G286)
4lceA Ctbp1 in complex with substrate mtob (see paper)
38% identity, 74% coverage: 72:303/315 of query aligns to 66:309/327 of 4lceA
- active site: S98 (≠ N104), R240 (= R235), D264 (= D259), E269 (= E264), H289 (= H283)
- binding 4-(methylsulfanyl)-2-oxobutanoic acid: R71 (≠ K77), G73 (= G79), S74 (= S80), G75 (= G81), R240 (= R235), H289 (= H283), W292 (≠ G286)
- binding nicotinamide-adenine-dinucleotide: S74 (= S80), T102 (≠ V108), G155 (= G154), G157 (= G156), R158 (≠ A157), V159 (≠ I158), Y177 (≠ F176), D178 (= D177), P179 (= P178), Y180 (= Y179), H210 (= H205), C211 (= C206), N214 (≠ T209), N217 (= N212), T238 (= T233), A239 (= A234), R240 (= R235), W292 (≠ G286)
Query Sequence
>H281DRAFT_05961 FitnessBrowser__Burk376:H281DRAFT_05961
MQTASHKPVVLVTAADLAPQALDMLTQFDVVFAGKQPTEDDIVALCAEHKPVAIIVRYGK
VNARIMDAAENLQVISKHGSGIDVIDQAAAAARGIAVRAAVGANAAAVAEHAWALILACA
KSVPHLDARMRQGHWDKSTHKSVELDGRTLGLVGLGAIGRRVAAIGAAFGMNVLAFDPYA
KEAPAGVKLVSLDELYAASDVVSLHCPLTAENRQMLNRDTLARFKRGAILVNTARGGLID
EAALAEALASGQLRFAGLDSFDVEPMTYPHPFQQIPNAILSPHIGGVSDAAYVNMGKGAA
ANVLAVVEEHARNAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory