SitesBLAST
Comparing H281DRAFT_06109 FitnessBrowser__Burk376:H281DRAFT_06109 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 98% coverage: 5:251/252 of query aligns to 1:247/247 of 4jroC
- active site: G16 (= G20), S142 (= S145), Q152 (≠ L155), Y155 (= Y158), K159 (= K162)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ A18), R15 (≠ S19), G16 (= G20), I17 (= I21), N35 (≠ D40), Y36 (≠ L41), N37 (= N42), G38 (≠ E43), S39 (≠ A44), N63 (≠ D66), V64 (= V67), N90 (= N93), A91 (= A94), I93 (≠ M96), I113 (≠ V116), S142 (= S145), Y155 (= Y158), K159 (= K162), P185 (= P188), I188 (= I191), T190 (= T193)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
37% identity, 96% coverage: 10:251/252 of query aligns to 5:246/246 of 3osuA
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
38% identity, 94% coverage: 7:243/252 of query aligns to 2:236/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), M16 (≠ I21), D35 (= D40), I36 (≠ L41), I62 (≠ V67), N88 (= N93), G90 (= G95), I138 (≠ V143), S140 (= S145), Y152 (= Y158), K156 (= K162), I185 (= I191)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
38% identity, 94% coverage: 7:243/252 of query aligns to 3:237/248 of Q9KJF1
- S15 (= S19) binding
- D36 (= D40) binding
- D62 (= D66) binding
- I63 (≠ V67) binding
- N89 (= N93) binding
- Y153 (= Y158) binding
- K157 (= K162) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
37% identity, 91% coverage: 7:235/252 of query aligns to 4:244/260 of 6zzqA
- active site: G17 (= G20), S142 (= S145), Y155 (= Y158)
- binding acetoacetic acid: Q94 (≠ L97), S142 (= S145), K152 (≠ L155), Y155 (= Y158), Q196 (≠ I199)
- binding nicotinamide-adenine-dinucleotide: G13 (= G16), S16 (= S19), G17 (= G20), I18 (= I21), D37 (= D40), M38 (≠ L41), D63 (= D66), V64 (= V67), N90 (= N93), A91 (= A94), G92 (= G95), M140 (≠ V143), A141 (= A144), S142 (= S145), Y155 (= Y158), K159 (= K162), Y187 (≠ P190), V188 (≠ I191), T190 (= T193)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
37% identity, 91% coverage: 7:235/252 of query aligns to 5:245/261 of 6zzsD
- active site: G18 (= G20), S143 (= S145), Y156 (= Y158)
- binding nicotinamide-adenine-dinucleotide: G14 (= G16), S17 (= S19), I19 (= I21), D38 (= D40), M39 (≠ L41), D64 (= D66), V65 (= V67), N91 (= N93), A92 (= A94), G93 (= G95), M141 (≠ V143), A142 (= A144), S143 (= S145), Y156 (= Y158), K160 (= K162), P186 (= P188), G187 (= G189), V189 (≠ I191), T191 (= T193), L193 (= L195)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ L97), S143 (= S145), N145 (≠ L147), K153 (≠ L155), Y156 (= Y158), Q197 (≠ I199)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
39% identity, 90% coverage: 4:231/252 of query aligns to 2:225/244 of 4nbuB
- active site: G18 (= G20), N111 (≠ D117), S139 (= S145), Q149 (≠ L155), Y152 (= Y158), K156 (= K162)
- binding acetoacetyl-coenzyme a: D93 (≠ Q99), K98 (≠ D104), S139 (= S145), N146 (≠ G152), V147 (≠ A153), Q149 (≠ L155), Y152 (= Y158), F184 (≠ P190), M189 (≠ L195), K200 (≠ A206)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), N17 (≠ S19), G18 (= G20), I19 (= I21), D38 (= D40), F39 (≠ L41), V59 (≠ A65), D60 (= D66), V61 (= V67), N87 (= N93), A88 (= A94), G89 (= G95), I90 (≠ M96), T137 (≠ V143), S139 (= S145), Y152 (= Y158), K156 (= K162), P182 (= P188), F184 (≠ P190), T185 (≠ I191), T187 (= T193), M189 (≠ L195)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
39% identity, 96% coverage: 6:248/252 of query aligns to 2:236/239 of 4nbtA
- active site: G16 (= G20), S132 (= S145), Y145 (= Y158), K149 (= K162)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), K15 (≠ S19), G16 (= G20), L17 (≠ I21), D36 (= D40), L37 (= L41), L52 (≠ A65), N53 (≠ D66), V54 (= V67), N80 (= N93), A81 (= A94), G82 (= G95), I130 (≠ V143), S132 (= S145), Y145 (= Y158), K149 (= K162), P177 (= P188), G178 (= G189), I180 (= I191), T182 (= T193)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
37% identity, 99% coverage: 2:251/252 of query aligns to 1:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ A18), R18 (≠ S19), I20 (= I21), T40 (≠ L41), N62 (≠ D66), V63 (= V67), N89 (= N93), A90 (= A94), I92 (≠ M96), V139 (= V143), S141 (= S145), Y154 (= Y158), K158 (= K162), P184 (= P188), G185 (= G189), I187 (= I191), T189 (= T193), M191 (≠ L195)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
37% identity, 96% coverage: 10:251/252 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G20), S138 (= S145), Q148 (≠ L155), Y151 (= Y158), K155 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G16), S10 (≠ A18), R11 (≠ S19), I13 (= I21), N31 (≠ A39), Y32 (≠ D40), A33 (≠ L41), G34 (vs. gap), S35 (≠ N42), A58 (= A65), N59 (≠ D66), V60 (= V67), N86 (= N93), A87 (= A94), T109 (≠ V116), S138 (= S145), Y151 (= Y158), K155 (= K162), P181 (= P188), G182 (= G189)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
38% identity, 99% coverage: 2:251/252 of query aligns to 1:242/243 of 4i08A
- active site: G19 (= G20), N113 (≠ D117), S141 (= S145), Q151 (≠ L155), Y154 (= Y158), K158 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G16), S17 (≠ A18), R18 (≠ S19), I20 (= I21), T40 (≠ L41), N62 (≠ D66), V63 (= V67), N89 (= N93), A90 (= A94), G140 (≠ A144), S141 (= S145), Y154 (= Y158), K158 (= K162), P184 (= P188), G185 (= G189), T189 (= T193)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 98% coverage: 5:251/252 of query aligns to 1:243/244 of P0AEK2
- GASR 12:15 (≠ GAAS 16:19) binding
- T37 (≠ L41) binding
- NV 59:60 (≠ DV 66:67) binding
- N86 (= N93) binding
- Y151 (= Y158) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (= YAAAK 158:162) binding
- A154 (= A161) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K162) mutation to A: Defect in the affinity for NADPH.
- I184 (= I191) binding
- E233 (≠ Q241) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
40% identity, 96% coverage: 7:248/252 of query aligns to 2:256/260 of 2ztlA
- active site: G15 (= G20), N114 (≠ D117), S142 (= S145), Y155 (= Y158), K159 (= K162), L200 (vs. gap)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ L97), S142 (= S145), H144 (≠ L147), K152 (≠ L155), Y155 (= Y158), Q196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), G15 (= G20), I16 (= I21), F36 (≠ L41), L64 (≠ V67), N90 (= N93), A91 (= A94), G92 (= G95), L113 (≠ V116), Y155 (= Y158), K159 (= K162), P185 (= P188), W187 (≠ P190), V188 (≠ I191), T190 (= T193), V193 (= V196)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
40% identity, 96% coverage: 7:248/252 of query aligns to 2:256/260 of 1wmbA
Sites not aligning to the query:
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
37% identity, 98% coverage: 6:251/252 of query aligns to 1:242/243 of 1q7bA
- active site: G15 (= G20), E101 (≠ M109), S137 (= S145), Q147 (≠ L155), Y150 (= Y158), K154 (= K162)
- binding calcium ion: E232 (≠ Q241), T233 (= T242)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), S13 (≠ A18), R14 (≠ S19), T36 (≠ L41), N58 (≠ D66), V59 (= V67), N85 (= N93), A86 (= A94), G87 (= G95), I88 (≠ M96), S137 (= S145), Y150 (= Y158), K154 (= K162), P180 (= P188), G181 (= G189), I183 (= I191)
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
38% identity, 98% coverage: 5:251/252 of query aligns to 8:253/254 of 4ag3A
- active site: G23 (= G20), S148 (= S145), Y161 (= Y158), K165 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G16), S21 (≠ A18), R22 (≠ S19), G23 (= G20), I24 (= I21), T44 (≠ L41), L68 (≠ A65), D69 (= D66), V70 (= V67), N96 (= N93), A97 (= A94), I146 (≠ V143), S148 (= S145), Y161 (= Y158), K165 (= K162), P191 (= P188), G192 (= G189), F193 (≠ P190), I194 (= I191), T196 (= T193), M198 (≠ L195), T199 (≠ V196)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
36% identity, 98% coverage: 5:251/252 of query aligns to 1:243/244 of 6t77A
- active site: G16 (= G20), S138 (= S145), Y151 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), S14 (≠ A18), R15 (≠ S19), T37 (≠ L41), L58 (≠ A65), N59 (≠ D66), V60 (= V67), A87 (= A94), G88 (= G95), I89 (≠ M96)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
37% identity, 97% coverage: 5:248/252 of query aligns to 7:245/254 of 3o03A
- active site: G22 (= G20), S147 (= S145), V157 (≠ L155), Y160 (= Y158), K164 (= K162)
- binding calcium ion: S147 (= S145), M148 (≠ Q146), P190 (= P188)
- binding D-gluconic acid: I99 (≠ L97), R101 (≠ Q99), S147 (= S145), M149 (≠ L147), R154 (≠ G152), Y160 (= Y158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G16), Y21 (≠ S19), G22 (= G20), I23 (= I21), D42 (= D40), I43 (≠ L41), L47 (≠ R45), D68 (= D66), V69 (= V67), N95 (= N93), A96 (= A94), G97 (= G95), I145 (≠ V143), Y160 (= Y158), K164 (= K162), P190 (= P188)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
36% identity, 98% coverage: 6:251/252 of query aligns to 1:242/243 of 1q7cA
- active site: G15 (= G20), S137 (= S145), Q147 (≠ L155), F150 (≠ Y158), K154 (= K162)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G16), S13 (≠ A18), R14 (≠ S19), A35 (≠ D40), T36 (≠ L41), L57 (≠ A65), N58 (≠ D66), V59 (= V67), G87 (= G95), I88 (≠ M96)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 98% coverage: 5:251/252 of query aligns to 1:243/244 of P0A2C9
- M125 (= M132) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A230) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S231) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
Query Sequence
>H281DRAFT_06109 FitnessBrowser__Burk376:H281DRAFT_06109
MASMFSLDGRRAVVTGAASGIGAAIALAYAQAGARLVLADLNEARLAAHADACRANGVEV
QTIVADVGDETGAHGIVDRCIAAYGGIDILVNNAGMLTQARCTDLTTQMWDDMLRVDLRS
VFLCSRRALPSMTAQRWGRIINVASQLGIKGGAELTHYAAAKAGVIGFTKSLALEAAPDN
VLVNAIAPGPIETPLVDGISASWKEAKSKELPLRRFGRADEVAPTAVLLASDPGGNLFVG
QTLGPNSGDVMP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory