SitesBLAST
Comparing H281DRAFT_06210 FitnessBrowser__Burk376:H281DRAFT_06210 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09339 Aconitate hydratase A; ACN; Aconitase; Aconitate/2-methylaconitate hydratase; Iron-responsive protein-like; IRP-like; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.- from Bacillus subtilis (strain 168) (see 2 papers)
47% identity, 96% coverage: 13:873/898 of query aligns to 18:901/909 of P09339
- C450 (= C420) mutation to S: Loss of aconitase activity. It is glutamate auxotroph and accumulates citrate. Exhibits overexpression of the citB promoter and accumulates high levels of inactive aconitase.
- R741 (= R712) mutation to E: Same aconitase activity compared to the wild-type. It is glutamate prototroph and accumulates citrate. Exhibits overexpression of the citB promoter and accumulates high levels of active aconitase.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q9SIB9 Aconitate hydratase 3, mitochondrial; Aconitase 3; mACO1; Citrate hydro-lyase 3; EC 4.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
49% identity, 94% coverage: 37:877/898 of query aligns to 128:987/990 of Q9SIB9
Sites not aligning to the query:
- 91 modified: Phosphoserine
2b3xA Structure of an orthorhombic crystal form of human cytosolic aconitase (irp1) (see paper)
47% identity, 95% coverage: 22:877/898 of query aligns to 19:886/888 of 2b3xA
- active site: D124 (= D125), H125 (= H126), D204 (= D209), R535 (= R519), S777 (= S763), R779 (= R765)
- binding iron/sulfur cluster: I175 (= I176), H206 (= H211), C436 (= C420), C502 (= C486), C505 (= C489), I506 (≠ A490), N534 (= N518)
P21399 Cytoplasmic aconitate hydratase; Aconitase; Citrate hydro-lyase; Ferritin repressor protein; Iron regulatory protein 1; IRP1; Iron-responsive element-binding protein 1; IRE-BP 1; EC 4.2.1.3 from Homo sapiens (Human) (see 2 papers)
47% identity, 95% coverage: 22:877/898 of query aligns to 20:887/889 of P21399
- C300 (≠ A304) mutation to S: No effect on aconitase activity or on RNA binding.
- T318 (≠ E322) to M: in dbSNP:rs150373174
- C437 (= C420) mutation to S: Loss of aconitase activity. Leads to constitutive RNA binding, irrespective of iron levels.
- C503 (= C486) mutation to S: Loss of aconitase activity. Leads to constitutive RNA binding, irrespective of iron levels.
- C506 (= C489) mutation to S: Loss of aconitase activity. Leads to constitutive RNA binding, irrespective of iron levels.
- R536 (= R519) mutation to Q: Strongly reduced RNA binding.
- R541 (= R524) mutation to Q: Strongly reduced RNA binding.
- R699 (≠ A683) mutation to K: No effect on RNA binding.
- S778 (= S763) mutation to A: No effect on iron-regulated RNA binding. Loss of aconitase activity.
- R780 (= R765) mutation to Q: Nearly abolishes RNA binding.
3snpA Crystal structure analysis of iron regulatory protein 1 in complex with ferritin h ire RNA (see paper)
46% identity, 93% coverage: 40:877/898 of query aligns to 34:848/850 of 3snpA
- active site: D124 (= D125), H125 (= H126), D186 (= D209), R505 (= R519), S739 (= S763), R741 (= R765)
- binding : H125 (= H126), S126 (= S127), H188 (= H211), L243 (= L266), R250 (= R273), N279 (= N302), E283 (= E306), S352 (≠ A376), P357 (= P381), K360 (≠ R384), T419 (= T421), N420 (= N422), T421 (= T423), N504 (= N518), R505 (= R519), L520 (= L534), S642 (= S665), P643 (= P666), A644 (≠ V667), G645 (= G668), N646 (≠ V669), R649 (≠ S672), R665 (≠ S688), S669 (≠ T692), G671 (≠ L694), R674 (= R697), R741 (= R765)
D9X0I3 Aconitate hydratase A; ACN; Aconitase; EC 4.2.1.3 from Streptomyces viridochromogenes (strain DSM 40736 / JCM 4977 / BCRC 1201 / Tue 494) (see paper)
49% identity, 53% coverage: 407:878/898 of query aligns to 459:929/931 of D9X0I3
- C538 (= C486) mutation to A: Loss of aconitase activity. Cannot rescue the growth defect of a disruption mutant and results in only a slight increase in PTT production in the mutant. Shows weak IRE-binding activity.
- R763 (= R712) mutation to E: Loss of aconitase activity and IRE-binding activity; when associated with E-767.
- Q767 (≠ E716) mutation to E: Loss of aconitase activity and IRE-binding activity; when associated with E-763.
Sites not aligning to the query:
- 125:129 mutation Missing: Retains 40% of aconitase activity. Improves RNA-binding ability.
A0QX20 Aconitate hydratase A; ACN; Aconitase; (2R,3S)-2-methylisocitrate dehydratase; (2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate dehydratase; Iron-responsive protein-like; IRP-like; Probable 2-methyl-cis-aconitate hydratase; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.99 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
46% identity, 53% coverage: 402:878/898 of query aligns to 457:939/943 of A0QX20
Sites not aligning to the query:
- 394 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
P19414 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
27% identity, 84% coverage: 119:875/898 of query aligns to 117:774/778 of P19414
- R604 (≠ A683) mutation to K: Strongly diminishes the catalytic activity towards both known substrates, aconitate and homoaconitate.
Sites not aligning to the query:
- 1:16 modified: transit peptide, Mitochondrion
8acnA Crystal structures of aconitase with isocitrate and nitroisocitrate bound (see paper)
29% identity, 84% coverage: 118:871/898 of query aligns to 92:745/753 of 8acnA
- active site: D99 (= D125), H100 (= H126), D164 (= D209), R446 (= R519), S641 (= S763), R643 (= R765)
- binding nitroisocitric acid: H100 (= H126), D164 (= D209), S165 (= S210), R446 (= R519), R451 (= R524), R579 (≠ A683), S641 (= S763), S642 (= S764), R643 (= R765)
- binding iron/sulfur cluster: H100 (= H126), D164 (= D209), H166 (= H211), S356 (= S419), C357 (= C420), C420 (= C486), C423 (= C489), I424 (≠ A490)
Sites not aligning to the query:
1fghA Complex with 4-hydroxy-trans-aconitate (see paper)
29% identity, 84% coverage: 118:871/898 of query aligns to 92:745/753 of 1fghA
- active site: D99 (= D125), H100 (= H126), D164 (= D209), R446 (= R519), S641 (= S763), R643 (= R765)
- binding 4-hydroxy-aconitate ion: H100 (= H126), D164 (= D209), S165 (= S210), R446 (= R519), R451 (= R524), R579 (≠ A683), S641 (= S763), S642 (= S764), R643 (= R765)
- binding iron/sulfur cluster: H100 (= H126), D164 (= D209), H166 (= H211), S356 (= S419), C357 (= C420), C420 (= C486), C423 (= C489), I424 (≠ A490), R451 (= R524)
Sites not aligning to the query:
1amjA Steric and conformational features of the aconitase mechanism (see paper)
29% identity, 84% coverage: 118:871/898 of query aligns to 92:745/753 of 1amjA
- active site: D99 (= D125), H100 (= H126), D164 (= D209), R446 (= R519), S641 (= S763), R643 (= R765)
- binding iron/sulfur cluster: I144 (= I176), H166 (= H211), C357 (= C420), C420 (= C486), C423 (= C489)
- binding sulfate ion: R579 (≠ A683), R643 (= R765)
Sites not aligning to the query:
1amiA Steric and conformational features of the aconitase mechanism (see paper)
29% identity, 84% coverage: 118:871/898 of query aligns to 92:745/753 of 1amiA
- active site: D99 (= D125), H100 (= H126), D164 (= D209), R446 (= R519), S641 (= S763), R643 (= R765)
- binding alpha-methylisocitric acid: H100 (= H126), D164 (= D209), S165 (= S210), R446 (= R519), R451 (= R524), R579 (≠ A683), S641 (= S763), S642 (= S764), R643 (= R765)
- binding iron/sulfur cluster: H100 (= H126), I144 (= I176), D164 (= D209), H166 (= H211), S356 (= S419), C357 (= C420), C420 (= C486), C423 (= C489), N445 (= N518)
Sites not aligning to the query:
1acoA Crystal structure of aconitase with transaconitate bound (see paper)
29% identity, 84% coverage: 118:871/898 of query aligns to 92:745/753 of 1acoA
- active site: D99 (= D125), H100 (= H126), D164 (= D209), R446 (= R519), S641 (= S763), R643 (= R765)
- binding iron/sulfur cluster: H100 (= H126), I144 (= I176), D164 (= D209), H166 (= H211), S356 (= S419), C357 (= C420), C420 (= C486), C423 (= C489), N445 (= N518)
- binding aconitate ion: D164 (= D209), S165 (= S210), R446 (= R519), R451 (= R524), R579 (≠ A683), S641 (= S763), S642 (= S764), R643 (= R765)
Sites not aligning to the query:
5acnA Structure of activated aconitase. Formation of the (4fe-4s) cluster in the crystal (see paper)
29% identity, 84% coverage: 118:871/898 of query aligns to 93:746/754 of 5acnA
- active site: D100 (= D125), H101 (= H126), D165 (= D209), R447 (= R519), S642 (= S763), R644 (= R765)
- binding fe3-s4 cluster: I145 (= I176), H147 (= H178), H167 (= H211), C358 (= C420), C421 (= C486), C424 (= C489), N446 (= N518)
- binding tricarballylic acid: K198 (≠ L242), G235 (= G279), R666 (= R787)
P20004 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Bos taurus (Bovine) (see 2 papers)
29% identity, 84% coverage: 118:871/898 of query aligns to 120:773/780 of P20004
- DSH 192:194 (= DSH 209:211) binding substrate
- C385 (= C420) binding [4Fe-4S] cluster
- C448 (= C486) binding [4Fe-4S] cluster
- C451 (= C489) binding [4Fe-4S] cluster
- R474 (= R519) binding substrate
- R479 (= R524) binding substrate
- R607 (≠ A683) binding substrate
- SR 670:671 (= SR 764:765) binding substrate
Sites not aligning to the query:
1nisA Crystal structure of aconitase with trans-aconitate and nitrocitrate bound (see paper)
29% identity, 84% coverage: 118:871/898 of query aligns to 92:745/753 of 1nisA
- active site: D99 (= D125), H100 (= H126), D164 (= D209), R446 (= R519), S641 (= S763), R643 (= R765)
- binding 2-hydroxy-2-nitromethyl succinic acid: H100 (= H126), D164 (= D209), S165 (= S210), R446 (= R519), R451 (= R524), R579 (≠ A683), S641 (= S763), S642 (= S764)
- binding iron/sulfur cluster: H100 (= H126), I144 (= I176), H166 (= H211), S356 (= S419), C357 (= C420), C420 (= C486), C423 (= C489)
Sites not aligning to the query:
1b0kA S642a:fluorocitrate complex of aconitase (see paper)
29% identity, 84% coverage: 118:871/898 of query aligns to 92:745/753 of 1b0kA
- active site: D99 (= D125), H100 (= H126), D164 (= D209), R446 (= R519), A641 (≠ S763), R643 (= R765)
- binding citrate anion: H100 (= H126), D164 (= D209), S165 (= S210), R446 (= R519), R451 (= R524), R579 (≠ A683), A641 (≠ S763), S642 (= S764), R643 (= R765)
- binding oxygen atom: D164 (= D209), H166 (= H211)
- binding iron/sulfur cluster: H100 (= H126), D164 (= D209), H166 (= H211), S356 (= S419), C357 (= C420), C420 (= C486), C423 (= C489)
Sites not aligning to the query:
P16276 Aconitate hydratase, mitochondrial; Aconitase; Citrate hydro-lyase; EC 4.2.1.3 from Sus scrofa (Pig) (see 3 papers)
29% identity, 84% coverage: 118:871/898 of query aligns to 120:773/781 of P16276
- DSH 192:194 (= DSH 209:211) binding substrate
- C385 (= C420) binding [4Fe-4S] cluster
- C448 (= C486) binding [4Fe-4S] cluster
- C451 (= C489) binding [4Fe-4S] cluster
- R474 (= R519) binding substrate
- R479 (= R524) binding substrate
- R607 (≠ A683) binding substrate
- SR 670:671 (= SR 764:765) binding substrate
Sites not aligning to the query:
- 28 modified: Pyrrolidone carboxylic acid
- 99 binding substrate
P39533 Homocitrate dehydratase, mitochondrial; Aconitase 2; EC 4.2.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 54% coverage: 73:560/898 of query aligns to 83:514/789 of P39533
Sites not aligning to the query:
- 610 K→R: Reduces catalytic activity towards homoaconitate by 45% and increases the activity towards aconitate by a factor 116.
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 43% coverage: 188:571/898 of query aligns to 118:492/758 of O14289
- S486 (≠ Q565) modified: Phosphoserine
- S488 (≠ V567) modified: Phosphoserine
Query Sequence
>H281DRAFT_06210 FitnessBrowser__Burk376:H281DRAFT_06210
MSSIRMEDVLWTTLETASGPLRYADLKRAEAQGFAPLSELPVSLRILLENAMRRGGVDDV
AAIRDWLTRRESDREISFFPVRVLMPDSSAVPLVADLAAMRDAVRKKGGDSWRVNPLIPV
DIVVDHSAITDHAGRSDAFDLNLALEYQRNHERYAFLKWAQNAFDNVRVVPPATGIVHQV
NLEFLAAGVQTVVIDDVTFVVPDTLVGMDSHTTMVNSIGVLGWGVGGIEAAAAILGQPIS
MLLPRVIGCRISGRPRSGVTCTDIVLSLTEFLRGKKVVGCFVEFFGEGLDNLPVSDRATI
ANMAPEAGATMCFFPPDAATIEYLHATGRSREQVAVAEAVLKAQGIWRPEAGADEERIAY
SDRLEFDLSAVTPSMAGPKRPQDRVDLKDVSARFHREFGLTAEGRGLTNGSVVIAAITSC
TNTSNARAMIGAGLIARNLRARGVKPKAWVKTSLSPGSRVVTDYLRESGLQDDLDSLGFN
LTGYGCMTCAGSSGQLDAEVARRILSEGLVVATVLSGNRNFEGRTHPLARANFLGSPALV
VAYACAGTILRDLTTEPIADEADGQPVMLADVWPDDADIDAIFRRIVTLTMFKRVYATAF
QGEARWQRIAAASGDHFDWDQASTYIRRPPYFDAGFADDGFGMANIVGARALLMLGDSIT
TDHISPVGVIRSETEAGRFLHGAGVAPSDFNTLLSRRANHDVMMRGTFANVRLRNEMTPD
REGPWSRHVPSGDVMRVFQAASRYRDERVPLIVIAGADYGAGSSRDWAAKGPRLLGVRAV
IAESFERIHRSNLVGMGILPLQFPPGTTRKTLGLTGEESFTIFGIEGALQPHQRIECEVS
RANGARDSITLICRLDIPREIAWYRHGGVLQYIAAQLLLPAAAVTEQHLASQLNGASS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory