Comparing H281DRAFT_06224 FitnessBrowser__Burk376:H281DRAFT_06224 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 98% coverage: 1:318/326 of query aligns to 110:423/440 of O04373
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
40% identity, 96% coverage: 1:314/326 of query aligns to 74:372/380 of P54955
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 98% coverage: 1:318/326 of query aligns to 114:427/442 of P54968
Sites not aligning to the query:
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
31% identity, 84% coverage: 1:273/326 of query aligns to 79:350/389 of 4ewtA
Sites not aligning to the query:
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
33% identity, 80% coverage: 1:261/326 of query aligns to 80:344/398 of 6slfA
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
25% identity, 58% coverage: 19:208/326 of query aligns to 90:284/377 of 7t1qA
Sites not aligning to the query:
>H281DRAFT_06224 FitnessBrowser__Burk376:H281DRAFT_06224
MDALPIQELNSFEHKSKNDGKMHACGHDGHTAMLLGAARHLAKHGEFDGTIVFIFQPAEE
GGAGAQAMIDDGLFEKFPVDAVFGIHNWPGMPAGKFGVTEGPIMASSNEFRIEIKGVGSH
AALPHNGRDPVFTAVQIANGLQSIITRNKKPLDTAVLSITQIHAGDAVNVVPNDAWLAGT
VRTFTTETLDLIEARMRKIVENTAEAYDCSAKVHFHRNYPPTINSGDEARFAASVMKEIV
GAENVDDSVEPTMGAEDFSFMLLAKPGCYAFLGNGDGGHRDAGHGAGPCMLHNASYDFND
ELLPIGSTYWVRLAQRFLAGNDTTDR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory