SitesBLAST
Comparing H281DRAFT_06226 FitnessBrowser__Burk376:H281DRAFT_06226 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P69451 Long-chain-fatty-acid--CoA ligase; Long-chain acyl-CoA synthetase; Acyl-CoA synthetase; EC 6.2.1.3 from Escherichia coli (strain K12) (see paper)
57% identity, 99% coverage: 1:554/557 of query aligns to 1:551/561 of P69451
- Y213 (= Y211) mutation to A: Loss of activity.
- T214 (= T212) mutation to A: 10% of wild-type activity.
- G216 (= G214) mutation to A: Decreases activity.
- T217 (= T215) mutation to A: Decreases activity.
- G219 (= G217) mutation to A: Decreases activity.
- K222 (= K220) mutation to A: Decreases activity.
- E361 (= E363) mutation to A: Loss of activity.
Q9S725 4-coumarate--CoA ligase 2; 4CL 2; 4-coumarate--CoA ligase isoform 2; At4CL2; 4-coumaroyl-CoA synthase 2; Caffeate--CoA ligase; EC 6.2.1.12; EC 6.2.1.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
29% identity, 94% coverage: 31:553/557 of query aligns to 44:547/556 of Q9S725
- K211 (= K220) mutation to S: Drastically reduces the activity.
- M293 (≠ P306) mutation M->A,P: Affects the substrate specificity.
- K320 (≠ N333) mutation K->L,A: Affects the substrate specificity.
- E401 (= E408) mutation to Q: Slighlty reduces the substrate specificity.
- C403 (= C410) mutation to A: Significantly reduces the substrate specificity.
- R449 (= R456) mutation to Q: Drastically reduces the activity.
- K457 (≠ S464) mutation to S: Drastically reduces the activity.
- K540 (= K546) mutation to N: Abolishes the activity.
4gxqA Crystal structure of atp bound rpmatb-bxbclm chimera b1 (see paper)
31% identity, 92% coverage: 44:554/557 of query aligns to 24:499/506 of 4gxqA
- active site: T163 (= T212), N183 (= N232), H207 (= H263), T303 (≠ S362), E304 (= E363), I403 (≠ L462), N408 (= N467), A491 (≠ K546)
- binding adenosine-5'-triphosphate: T163 (= T212), S164 (≠ G213), G165 (= G214), T166 (= T215), T167 (= T216), H207 (= H263), S277 (≠ G336), A278 (≠ M337), P279 (≠ A338), E298 (= E357), M302 (≠ L361), T303 (≠ S362), D382 (= D441), R397 (= R456)
- binding carbonate ion: H207 (= H263), S277 (≠ G336), R299 (≠ G358), G301 (= G360)
Q67W82 4-coumarate--CoA ligase 4; 4CL 4; Os4CL4; (E)-ferulate--CoA ligase; 4-coumaroyl-CoA synthase 4; Protein RESISTANCE TO ALUMINUM 1; EC 6.2.1.12; EC 6.2.1.34 from Oryza sativa subsp. japonica (Rice) (see paper)
29% identity, 91% coverage: 46:553/557 of query aligns to 57:542/559 of Q67W82
- G395 (= G407) mutation to R: In ral1; reduced lignin content and increased accumulation of 4-coumarate and ferulate in roots; confers increased tolerance to aluminum.
3ni2A Crystal structures and enzymatic mechanisms of a populus tomentosa 4- coumarate:coa ligase (see paper)
27% identity, 94% coverage: 31:554/557 of query aligns to 26:527/528 of 3ni2A
- active site: S182 (≠ T212), S202 (≠ N232), H230 (= H263), T329 (≠ S362), E330 (= E363), K434 (≠ L462), Q439 (≠ N467), K519 (= K546)
- binding 5'-O-{(S)-hydroxy[3-(4-hydroxyphenyl)propoxy]phosphoryl}adenosine: Y232 (≠ F265), S236 (≠ V269), G302 (= G336), A303 (≠ M337), P304 (≠ A338), G325 (= G358), G327 (= G360), T329 (≠ S362), P333 (= P366), V334 (vs. gap), D413 (= D441), K430 (= K458), K434 (≠ L462), Q439 (≠ N467)
3a9vA Crystal structures and enzymatic mechanisms of a populus tomentosa 4- coumarate--coa ligase (see paper)
27% identity, 94% coverage: 31:554/557 of query aligns to 26:527/528 of 3a9vA
- active site: S182 (≠ T212), S202 (≠ N232), H230 (= H263), T329 (≠ S362), E330 (= E363), K434 (≠ L462), Q439 (≠ N467), K519 (= K546)
- binding adenosine monophosphate: H230 (= H263), G302 (= G336), A303 (≠ M337), P304 (≠ A338), Y326 (= Y359), G327 (= G360), M328 (≠ L361), T329 (≠ S362), D413 (= D441), K430 (= K458), K434 (≠ L462), Q439 (≠ N467)
5bsrA Crystal structure of 4-coumarate:coa ligase complexed with adenosine monophosphate and coenzyme a (see paper)
29% identity, 94% coverage: 31:553/557 of query aligns to 25:525/528 of 5bsrA
- active site: S181 (≠ T212), S201 (≠ N232), H229 (= H263), T328 (≠ S362), E329 (= E363), K433 (≠ L462), Q438 (≠ N467), K518 (= K546)
- binding adenosine monophosphate: A301 (vs. gap), G326 (= G360), T328 (≠ S362), D412 (= D441), K429 (= K458), K433 (≠ L462), Q438 (≠ N467)
- binding coenzyme a: L102 (= L106), P226 (= P260), H229 (= H263), Y231 (≠ F265), F253 (≠ R288), K435 (≠ S464), G436 (= G465), F437 (= F466), F498 (≠ G526)
5bsmA Crystal structure of 4-coumarate:coa ligase complexed with magnesium and adenosine triphosphate (see paper)
29% identity, 94% coverage: 31:553/557 of query aligns to 26:526/530 of 5bsmA
- active site: S182 (≠ T212), S202 (≠ N232), H230 (= H263), T329 (≠ S362), E330 (= E363), K434 (≠ L462), Q439 (≠ N467), K519 (= K546)
- binding adenosine-5'-triphosphate: S182 (≠ T212), S183 (≠ G213), G184 (= G214), T185 (= T215), T186 (= T216), K190 (= K220), H230 (= H263), A302 (vs. gap), A303 (vs. gap), P304 (vs. gap), Y326 (= Y359), G327 (= G360), M328 (≠ L361), T329 (≠ S362), D413 (= D441), I425 (= I453), R428 (= R456), K519 (= K546)
5bsvA Crystal structure of 4-coumarate:coa ligase complexed with feruloyl adenylate (see paper)
29% identity, 94% coverage: 31:553/557 of query aligns to 26:526/529 of 5bsvA
- active site: S182 (≠ T212), S202 (≠ N232), H230 (= H263), T329 (≠ S362), E330 (= E363), K434 (≠ L462), Q439 (≠ N467), K519 (= K546)
- binding 5'-O-[(R)-hydroxy{[(2E)-3-(5-methoxy-4-oxocyclohexa-1,5-dien-1-yl)prop-2-enoyl]oxy}phosphoryl]adenosine: H230 (= H263), Y232 (≠ F265), S236 (≠ V269), A302 (vs. gap), A303 (vs. gap), P304 (vs. gap), G325 (= G358), G327 (= G360), M328 (≠ L361), T329 (≠ S362), P333 (= P366), V334 (vs. gap), D413 (= D441), K430 (= K458), K434 (≠ L462), Q439 (≠ N467)
5bsuA Crystal structure of 4-coumarate:coa ligase complexed with caffeoyl adenylate (see paper)
29% identity, 94% coverage: 31:553/557 of query aligns to 26:526/529 of 5bsuA
- active site: S182 (≠ T212), S202 (≠ N232), H230 (= H263), T329 (≠ S362), E330 (= E363), K434 (≠ L462), Q439 (≠ N467), K519 (= K546)
- binding 5'-O-[(R)-{[(2E)-3-(3,4-dioxocyclohexa-1,5-dien-1-yl)prop-2-enoyl]oxy}(hydroxy)phosphoryl]adenosine: H230 (= H263), Y232 (≠ F265), S236 (≠ V269), M299 (≠ N333), A302 (vs. gap), A303 (vs. gap), P304 (vs. gap), G325 (= G358), G327 (= G360), M328 (≠ L361), T329 (≠ S362), P333 (= P366), D413 (= D441), K430 (= K458), K434 (≠ L462), Q439 (≠ N467)
5bstA Crystal structure of 4-coumarate:coa ligase complexed with coumaroyl adenylate (see paper)
29% identity, 94% coverage: 31:553/557 of query aligns to 26:526/529 of 5bstA
- active site: S182 (≠ T212), S202 (≠ N232), H230 (= H263), T329 (≠ S362), E330 (= E363), K434 (≠ L462), Q439 (≠ N467), K519 (= K546)
- binding 5'-O-[(R)-hydroxy{[(2E)-3-(4-oxocyclohexa-1,5-dien-1-yl)prop-2-enoyl]oxy}phosphoryl]adenosine: H230 (= H263), Y232 (≠ F265), S236 (≠ V269), A302 (vs. gap), A303 (vs. gap), P304 (vs. gap), G325 (= G358), Y326 (= Y359), G327 (= G360), M328 (≠ L361), T329 (≠ S362), P333 (= P366), V334 (vs. gap), D413 (= D441), K430 (= K458), K434 (≠ L462), Q439 (≠ N467)
O24146 4-coumarate--CoA ligase 2; 4CL 2; Nt4CL-19; Nt4CL-2; 4-coumaroyl-CoA synthase 2; Caffeate--CoA ligase; Cinnamate--CoA ligase; Ferulate--CoA ligase; EC 6.2.1.12; EC 6.2.1.-; EC 6.2.1.-; EC 6.2.1.34 from Nicotiana tabacum (Common tobacco) (see paper)
29% identity, 94% coverage: 31:553/557 of query aligns to 33:533/542 of O24146
- S189 (≠ T212) binding
- S190 (≠ G213) binding
- G191 (= G214) binding
- T192 (= T215) binding
- T193 (= T216) binding ; mutation to A: Reduced activity against 4-coumarate.
- K197 (= K220) binding ; mutation to A: Reduced activity against 4-coumarate.
- H237 (= H263) mutation to A: Strongly reduced activity against 4-coumarate.
- Y239 (≠ F265) binding ; binding ; binding ; mutation to A: Strongly reduced activity against 4-coumarate.; mutation to F: Reduced activity against 4-coumarate.
- S243 (≠ V269) binding ; binding ; binding
- K260 (≠ P287) binding
- A309 (vs. gap) binding ; binding ; binding
- Q331 (≠ E357) binding
- G332 (= G358) binding ; binding ; binding ; binding ; binding
- T336 (≠ S362) binding ; binding ; binding ; binding ; binding ; mutation to A: Strongly reduced activity against 4-coumarate.
- V341 (vs. gap) mutation to G: Reduced activity against 4-coumarate.; mutation Missing: Reduced activity against 4-coumarate, but acquired ability to use sinapate as substrate.
- M344 (vs. gap) binding ; binding ; binding ; mutation to A: Reduced activity against 4-coumarate.
- D420 (= D441) binding ; binding ; binding ; binding ; binding
- R435 (= R456) binding ; binding ; binding ; binding ; mutation to A: Strongly reduced activity against 4-coumarate.
- K437 (= K458) binding ; binding ; binding ; binding
- K441 (≠ L462) binding ; binding ; binding ; binding ; mutation to A: Abolished activity against 4-coumarate.
- K443 (≠ S464) binding ; mutation to A: Normal activity against 4-coumarate.
- G444 (= G465) binding
- Q446 (≠ N467) binding
- K526 (= K546) binding ; mutation to A: Abolished activity against 4-coumarate.
Q4WR83 Acyl-CoA ligase sidI; Siderophore biosynthesis protein I; EC 6.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
29% identity, 92% coverage: 42:553/557 of query aligns to 58:570/590 of Q4WR83
Sites not aligning to the query:
- 6:14 PTS2-type peroxisomal targeting signal
6k4cA Ancestral luciferase anclamp in complex with dlsa (see paper)
29% identity, 97% coverage: 14:553/557 of query aligns to 9:534/538 of 6k4cA
- binding 5'-o-[n-(dehydroluciferyl)-sulfamoyl] adenosine: H243 (= H263), F245 (= F265), T249 (= T268), G314 (= G334), A315 (≠ G335), P316 (≠ G336), G337 (= G358), Y338 (= Y359), G339 (= G360), L340 (= L361), T341 (≠ S362), A346 (≠ C367), D420 (= D441), I432 (= I453), K527 (= K546)
Q84P21 Peroxisomal OPC-8:0-CoA ligase 1; 4-coumarate--CoA ligase isoform 9; At4CL9; 4-coumarate--CoA ligase-like 5; EC 6.2.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 93% coverage: 34:552/557 of query aligns to 41:536/546 of Q84P21
- K530 (= K546) mutation to N: Lossed enzymatic activity.
6k4dA Ancestral luciferase anclamp in complex with atp and d-luciferin (see paper)
29% identity, 97% coverage: 14:553/557 of query aligns to 9:534/539 of 6k4dA
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (4S)-2-(6-oxidanyl-1,3-benzothiazol-2-yl)-4,5-dihydro-1,3-thiazole-4-carboxylate: H243 (= H263), F245 (= F265), T249 (= T268), G314 (= G334), A315 (≠ G335), P316 (≠ G336), G337 (= G358), Y338 (= Y359), G339 (= G360), L340 (= L361), T341 (≠ S362), S345 (≠ P366), A346 (≠ C367), D420 (= D441), I432 (= I453), K527 (= K546)
- binding (4S)-2-(6-hydroxy-1,3-benzothiazol-2-yl)-4,5-dihydro-1,3-thiazole-4-carboxylic acid: F245 (= F265), R335 (≠ I356), G337 (= G358), G339 (= G360), L340 (= L361), A346 (≠ C367)
5u95B Structure of the open conformation of 4-coumarate-coa ligase from nicotiana tabacum
29% identity, 94% coverage: 31:553/557 of query aligns to 25:522/527 of 5u95B
P9WQ37 Long-chain-fatty-acid--CoA ligase FadD13; Fatty acyl-CoA ligase; FACL; FACL13; Fatty acyl-CoA synthetase; ACS; FACS; Very-long-chain fatty-acyl-CoA synthetase; ACSVL; EC 6.2.1.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 4 papers)
29% identity, 91% coverage: 49:554/557 of query aligns to 30:495/503 of P9WQ37
- K172 (= K220) mutation to A: Slight reduction of the fatty acyl-CoA ligase activity. Slight increase of susceptibility to proteolysis.
- R195 (≠ D246) mutation to A: Alteration of the strength of the membrane binding; when associated with A-9; A-17; A-197 and A-244.
- R197 (≠ T248) mutation to A: Alteration of the strength of the membrane binding; when associated with A-9; A-17; A-195 and A-244.
- V209 (= V264) mutation to D: Strong reduction of the fatty acyl-CoA ligase activity. No significant change in the total expression level, however the cytoplasmic expression is reduced. Slight increase of susceptibility to proteolysis.
- A211 (= A266) mutation to G: Slight increase of the fatty acyl-CoA ligase activity. Reduced rate of proteolytic degradation.
- T214 (≠ V269) mutation to W: Shows a marked decrease in the activity with lauric and palmitic acid (C12 and C16 fatty acid) with a simultaneous increase in the activity with caprylic acid (C8 fatty acid).
- R244 (≠ A301) mutation to A: Alteration of the strength of the membrane binding; when associated with A-17; A-195; A-195 and A-197.
- A302 (≠ G360) mutation to G: Slight increase of the fatty acyl-CoA ligase activity. Reduced rate of proteolytic degradation.; mutation to W: Does not show activity with small, medium or long acyl chains.
- W377 (≠ F436) mutation to A: Strong reduction of the fatty acyl-CoA ligase activity. Enhanced affinity towards palmitic acid binding. No significant change in the total expression level, however the cytoplasmic expression is low. Slight increase of susceptibility to proteolysis.
- D382 (= D441) mutation to A: Strong reduction of the fatty acyl-CoA ligase activity. No significant change in the total expression level, however the cytoplasmic expression is reduced.
- R397 (= R456) mutation to A: Reduction of binding affinity for fatty acids.
- S404 (≠ V463) mutation to A: Slight reduction of the fatty acyl-CoA ligase activity. Enhanced affinity towards palmitic acid binding.
- G406 (= G465) mutation to L: No effect on the formation of acyl-adenylate intermediate. However, it shows very poor catalytic efficiency to form acyl-CoA.
- K487 (= K546) mutation to A: Strong reduction of the fatty acyl-CoA ligase activity. Reduction of binding affinity for ATP.
Sites not aligning to the query:
- 9 R→A: Alteration of the strength of the membrane binding; when associated with A-9; A-195; A-197 and A-244.
- 17 R→A: Alteration of the strength of the membrane binding; when associated with A-9; A-17; A-197 and A-244.
6m2uA The crystal structure of benzoate coenzyme a ligase double mutant (h333a/i334a) in complex with 2-chloro-1,3-thiazole-5-carboxylate-amp (see paper)
29% identity, 96% coverage: 19:555/557 of query aligns to 4:516/518 of 6m2uA
- active site: S176 (≠ T212), T196 (≠ Q235), T324 (≠ S362), E325 (= E363), K422 (≠ L462), Y427 (≠ N467), K507 (= K546)
- binding adenosine monophosphate: G298 (= G336), E299 (≠ M337), A300 (= A338), D319 (≠ E357), G320 (= G358), I321 (≠ Y359), G322 (= G360), T324 (≠ S362), D401 (= D441), R416 (= R456), K422 (≠ L462), Y427 (≠ N467)
- binding 2-chloranyl-1,3-thiazole-5-carboxylic acid: Y223 (≠ F265), A297 (≠ G335), G322 (= G360), S323 (≠ L361), A328 (≠ P366)
6m2tA The crystal structure of benzoate coenzyme a ligase double mutant (h333a/i334a) in complex with 2-methyl-thiazole-5 carboxylate-amp
29% identity, 96% coverage: 19:555/557 of query aligns to 4:516/518 of 6m2tA
- active site: S176 (≠ T212), T196 (≠ Q235), T324 (≠ S362), E325 (= E363), K422 (≠ L462), Y427 (≠ N467), K507 (= K546)
- binding 2-methyl-1,3-thiazole-5-carboxylic acid: Y223 (≠ F265), G322 (= G360), S323 (≠ L361), A328 (≠ P366)
- binding adenosine monophosphate: G298 (= G336), E299 (≠ M337), A300 (= A338), G320 (= G358), I321 (≠ Y359), S323 (≠ L361), T324 (≠ S362), D401 (= D441), R416 (= R456), K422 (≠ L462), Y427 (≠ N467)
Query Sequence
>H281DRAFT_06226 FitnessBrowser__Burk376:H281DRAFT_06226
MDKIWLKSYPPGVPAEIDPTRYSSVAELLEEAFREHRNKPAFVCMGKEISYGELDALSRK
LAAWFQSKGLARGARVAIMMPNVLQYPVAIAAILRAGYVVVNVNPLYTPRELEHQLKDSG
AEAIVLLENFAVTLQAVVRNTAVKHIVVAAMGDLMGVKGAVVNFVVRQVKKMVPAWSLPG
HVKFNTAIAEGERQTFKPVQQGPDDVAFLQYTGGTTGVAKGATLLHRNLIANVLQSEIWL
NPVRTDRTDIEQFITVVALPLYHVFALTVCGLLTIRTGGLGVLIPNPRDIPGMIKALQGY
AITTIPAVNTLYNALLNNPDFHKLDFSKLIAANGGGMAVQEAVAKRWFENTHTPIIEGYG
LSETSPCVTCNPVTVTEYSGTIGLPLPSTEVSIRDDEGNEVPLGQPGEICIRGPQVMAGY
WNRPDETAKVMTSDGFFRSGDVGFMNEQGFVKIVDRKKDMILVSGFNVYPNEIEDVVARL
PGVFEVAAVGVPDQHSGEAVKLFVVRKDDALTDADIFAYCKQQLTGYKRPKIVEFRTELP
KSNVGKILRRELRDGRA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory