Comparing H281DRAFT_06249 FitnessBrowser__Burk376:H281DRAFT_06249 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
Q04728 Arginine biosynthesis bifunctional protein ArgJ, mitochondrial; Extracellular mutant protein 40; EC 2.3.1.35; EC 2.3.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
40% identity, 96% coverage: 18:413/413 of query aligns to 31:441/441 of Q04728
Sites not aligning to the query:
Q07908 Arginine biosynthesis bifunctional protein ArgJ; EC 2.3.1.35; EC 2.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
40% identity, 92% coverage: 32:413/413 of query aligns to 36:410/410 of Q07908
P0DJQ5 Glutamate N-acetyltransferase 2; Ornithine acetyltransferase 2; Ornithine transacetylase 2; OATase 2; EC 2.3.1.35 from Streptomyces clavuligerus (see 2 papers)
35% identity, 92% coverage: 33:411/413 of query aligns to 26:391/393 of P0DJQ5
Sites not aligning to the query:
3it6B The crystal structure of ornithine acetyltransferase complexed with ornithine from mycobacterium tuberculosis (rv1653) at 2.4 a (see paper)
40% identity, 53% coverage: 197:413/413 of query aligns to 1:205/205 of 3it6B
2yepB Structure of an n-terminal nucleophile (ntn) hydrolase, oat2, in complex with glutamate (see paper)
32% identity, 52% coverage: 197:411/413 of query aligns to 1:211/213 of 2yepB
Sites not aligning to the query:
2yepA Structure of an n-terminal nucleophile (ntn) hydrolase, oat2, in complex with glutamate (see paper)
38% identity, 40% coverage: 32:196/413 of query aligns to 18:173/173 of 2yepA
3it6A The crystal structure of ornithine acetyltransferase complexed with ornithine from mycobacterium tuberculosis (rv1653) at 2.4 a (see paper)
38% identity, 36% coverage: 49:196/413 of query aligns to 47:193/193 of 3it6A
>H281DRAFT_06249 FitnessBrowser__Burk376:H281DRAFT_06249
MAVNFPSIDPAQLHPVAGVTLGWAEANIRKPNRKDVLVISVDEGATVGGVFTQNRFCAAP
VTVCRENLERVRAGGKPIRALVINTGNANAGTGEPGLVAARETCVELARLADIAPEQVLP
FSTGVILEPLPVDRLKAGLPAALANRKEANWYDAAQAIMTTDTLPKATSRQVTIDGHTVT
LTGISKGAGMIKPNMATMLGFLAFDAAVAQPVLDALVKHVADRSFNCITIDGDTSTNDSF
ILIASGKSSLPAITSTDSPAYAALRDAVTEVAQTLAQLIVRDGEGATKFMTVHVEGGSSV
GECRQIAYAIGHSPLVKTAFYASDPNLGRILAAIGYAGIDDLDVGKIDLYLDDVLVATAG
GRNPAYREEDGQRVMKKSEIGIRVVLGRGNAQATIWTCDLSHDYVSINADYRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory