Comparing H281DRAFT_06297 FitnessBrowser__Burk376:H281DRAFT_06297 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
4kzkA The structure of the periplasmic l-arabinose binding protein from burkholderia thailandensis
64% identity, 91% coverage: 29:329/332 of query aligns to 1:301/301 of 4kzkA
5abpA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
49% identity, 92% coverage: 29:332/332 of query aligns to 2:305/305 of 5abpA
1abfA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
49% identity, 92% coverage: 29:332/332 of query aligns to 2:305/305 of 1abfA
1abeA Novel stereospecificity of the l-arabinose-binding protein (see paper)
49% identity, 92% coverage: 29:332/332 of query aligns to 2:305/305 of 1abeA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
27% identity, 67% coverage: 27:247/332 of query aligns to 1:216/287 of 5dteB
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
24% identity, 87% coverage: 31:320/332 of query aligns to 3:273/274 of 2ioyA
>H281DRAFT_06297 FitnessBrowser__Burk376:H281DRAFT_06297
MKRRIFLTLAAAAAGVVFNAPVAQAADPVKIGFLVKQPEEPWFQDEWKFAEIAAKEKGFT
LVKIGAPSGEKVMSAIDNLSAQKAQGFVICTPDVKLGPGIVAKAKADGLKMMTVDDRLVD
GAGKPIASVPHMGISAYNIGKQVGDGLAAEIKKRGWDMKDVGAIDVTYEQLPTAHDRTSG
ATDALLAAGFPKANVIAAPQAKTDTENAFNAANIALTKNPQFKHWVAYALNDEGVLGAVR
AAEGRGFKADNMIGIGIGGSDSALNEFKKPNPTGFFGTVIISPKRHGEETATLMYDWITQ
GKAPPPLTLTTGMLATRENVGEVREKMGLASK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory