Comparing H281DRAFT_06298 FitnessBrowser__Burk376:H281DRAFT_06298 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
43% identity, 95% coverage: 8:501/519 of query aligns to 1:492/501 of P04983
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 47% coverage: 12:253/519 of query aligns to 5:251/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 47% coverage: 12:253/519 of query aligns to 5:251/253 of 1g9xB
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 48% coverage: 12:262/519 of query aligns to 2:238/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 48% coverage: 12:262/519 of query aligns to 3:239/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 48% coverage: 12:262/519 of query aligns to 3:239/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 48% coverage: 12:262/519 of query aligns to 3:239/344 of 3tuiC
7mdyC Lolcde nucleotide-bound
31% identity, 42% coverage: 12:227/519 of query aligns to 3:222/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 42% coverage: 12:227/519 of query aligns to 6:225/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
31% identity, 42% coverage: 12:227/519 of query aligns to 3:222/222 of 7arlD
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 40% coverage: 15:223/519 of query aligns to 5:212/240 of 4ymuJ
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
31% identity, 42% coverage: 12:227/519 of query aligns to 5:224/229 of 7v8iD
5x40A Structure of a cbio dimer bound with amppcp (see paper)
33% identity, 40% coverage: 21:227/519 of query aligns to 14:220/280 of 5x40A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 42% coverage: 12:228/519 of query aligns to 3:216/241 of 4u00A
4f4cA The crystal structure of the multi-drug transporter (see paper)
31% identity, 39% coverage: 22:226/519 of query aligns to 1034:1238/1250 of 4f4cA
Sites not aligning to the query:
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 44% coverage: 1:227/519 of query aligns to 1:228/265 of P07821
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
26% identity, 51% coverage: 15:279/519 of query aligns to 8:265/285 of 4yerA
Q61102 Iron-sulfur clusters transporter ABCB7, mitochondrial; ATP-binding cassette sub-family B member 7, mitochondrial; ATP-binding cassette transporter 7; ABC transporter 7 protein from Mus musculus (Mouse) (see paper)
29% identity, 47% coverage: 9:254/519 of query aligns to 469:714/752 of Q61102
Sites not aligning to the query:
7o9wA Encequidar-bound human p-glycoprotein in complex with uic2-fab (see paper)
30% identity, 40% coverage: 22:231/519 of query aligns to 941:1149/1169 of 7o9wA
Sites not aligning to the query:
7a6fA Nanodisc reconstituted human abcb1 in complex with mrk16 fab and zosuquidar (see paper)
30% identity, 40% coverage: 22:231/519 of query aligns to 936:1144/1164 of 7a6fA
Sites not aligning to the query:
>H281DRAFT_06298 FitnessBrowser__Burk376:H281DRAFT_06298
MKQRGGEVSATLRFDNIGKVFPGVRALDGVSFDVNVGQVHGLMGENGAGKSTLLKILGGE
YQPDSGRVMIDGKEVRFTSAASSIAAGIAVIHQELQYVPDLTVAENLLLGQLPNSFGWVN
KRDAKRFVRERLEAMGVALDPNAKLRKLSIAQRQMVEICKALLRNARVIALDEPTSSLSH
RETEVLFKLVRDLRADNRAMIYISHRMDEIYELCDACTIFRDGRKIASHPTLEGVSRDTI
VSEMVGREISDIYNYSERPLGEVRFAAKAIEGHALSQPASFEVRRGEIVGFFGLVGAGRS
ELMHLVYGTEHKKGGELVLDGKTIRVKSAGEAIRHGIVLCPEDRKEEGIVAMATVSENIN
ISCRRHYLRAGVFLDRKKEAETADRFIKLLKIKTPSRRQKIRFLSGGNQQKAILSRWLAE
PDLKVVILDEPTRGIDVGAKHEIYNVIYQLAERGCAIVMISSELPEVLGVSDRIVVMRQG
RIAGELSRKDATEQAVLSLALPQSSTALPATGTAAQQAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory