SitesBLAST
Comparing H281DRAFT_06337 FitnessBrowser__Burk376:H281DRAFT_06337 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
25% identity, 86% coverage: 27:390/424 of query aligns to 3:351/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I31), G8 (= G32), G10 (= G34), V11 (≠ F35), I12 (≠ T36), V30 (= V54), E31 (≠ D55), K32 (≠ A56), E38 (≠ G62), A39 (= A63), S40 (= S64), A43 (≠ N67), G45 (= G69), L46 (≠ Q70), V171 (= V206), G200 (≠ T234), G201 (= G235), W203 (≠ S237), G298 (= G340), R300 (≠ V342), P301 (≠ D343), Y326 (≠ S365), R327 (≠ G366), N328 (≠ H367), G329 (= G368), I330 (≠ T369)
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
23% identity, 88% coverage: 14:387/424 of query aligns to 13:370/383 of 5i39A
- active site: F66 (≠ N67), Q69 (= Q70), A70 (≠ V71), Q248 (≠ T278), P267 (≠ G298)
- binding flavin-adenine dinucleotide: V30 (≠ I31), G31 (= G32), G33 (= G34), I34 (≠ F35), L35 (≠ T36), V53 (= V54), E54 (≠ D55), K55 (≠ A56), Q62 (≠ A63), S63 (= S64), F66 (≠ N67), Y67 (≠ G68), Q69 (= Q70), A196 (= A205), A197 (≠ V206), G226 (≠ T234), G227 (= G235), W229 (= W244), Q248 (≠ T278), Q250 (≠ T280), G321 (= G340), M323 (≠ V342), T348 (≠ S365), G349 (= G366), W350 (≠ H367), G351 (= G368), M352 (≠ T369), T353 (≠ Q370)
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
27% identity, 52% coverage: 14:235/424 of query aligns to 5:219/433 of 5hxwA
- active site: F58 (≠ N67), Q61 (= Q70), A62 (≠ V71)
- binding flavin-adenine dinucleotide: V22 (≠ I31), G23 (= G32), G25 (= G34), I26 (≠ F35), L27 (≠ T36), E46 (≠ D55), K47 (≠ A56), E53 (≠ G62), Q54 (≠ A63), S55 (= S64), R57 (= R66), F58 (≠ N67), Y59 (≠ G68), G60 (= G69), Q61 (= Q70), A188 (= A205), A189 (≠ V206), G218 (≠ T234), G219 (= G235)
Sites not aligning to the query:
- active site: 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320, 373, 379, 399, 400
- binding flavin-adenine dinucleotide: 221, 240, 242, 331, 371, 373, 398, 399, 400, 401, 402, 403
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
24% identity, 84% coverage: 39:395/424 of query aligns to 18:358/369 of S5FMM4
- G51 (≠ N72) mutation to S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- A54 (≠ V75) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- K81 (≠ E106) mutation to R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
- S202 (≠ T234) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ T369) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (= M379) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
22% identity, 82% coverage: 44:392/424 of query aligns to 23:355/369 of O31616
- ES 34:35 (≠ DA 55:56) binding
- TT 42:43 (≠ AS 63:64) binding
- AGM 47:49 (≠ AAQ 83:85) binding
- G51 (= G87) mutation to R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; mutation to S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- A54 (≠ R90) mutation to R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- V174 (= V206) binding
- H244 (≠ Y286) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (≠ V342) binding
- 327:333 (vs. 364:370, 14% identical) binding
- R329 (≠ G366) binding
Sites not aligning to the query:
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
22% identity, 82% coverage: 44:392/424 of query aligns to 23:355/364 of 1ng3A
- active site: A47 (= A83), G48 (≠ A84), M49 (≠ Q85)
- binding acetylamino-acetic acid: Y246 (≠ R288), R302 (≠ V342), R329 (≠ G366)
- binding flavin-adenine dinucleotide: F33 (≠ V54), E34 (≠ D55), S35 (≠ A56), R41 (≠ G62), T42 (≠ A63), T43 (≠ S64), A46 (≠ L82), A47 (= A83), G48 (≠ A84), M49 (≠ Q85), V174 (= V206), S202 (≠ T234), G203 (= G235), W205 (≠ S237), F209 (≠ Y245), G300 (= G340), R302 (≠ V342), H327 (≠ Y364), R329 (≠ G366), N330 (≠ H367), G331 (= G368), I332 (≠ T369)
- binding phosphate ion: R89 (≠ D117), R254 (= R294)
Sites not aligning to the query:
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
22% identity, 82% coverage: 44:392/424 of query aligns to 23:355/364 of 3if9A
- active site: A47 (= A83), G48 (≠ A84), M49 (≠ Q85)
- binding flavin-adenine dinucleotide: E34 (≠ D55), S35 (≠ A56), T42 (≠ A63), T43 (≠ S64), A46 (≠ L82), A47 (= A83), G48 (≠ A84), M49 (≠ Q85), P173 (≠ A205), V174 (= V206), S202 (≠ T234), G203 (= G235), W205 (≠ S237), F209 (≠ Y245), G300 (= G340), R302 (≠ V342), H327 (≠ Y364), F328 (≠ S365), R329 (≠ G366), N330 (≠ H367), G331 (= G368), I332 (≠ T369)
- binding glycolic acid: Y246 (≠ R288), R302 (≠ V342), R329 (≠ G366)
Sites not aligning to the query:
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
26% identity, 75% coverage: 68:387/424 of query aligns to 50:355/370 of 4yshA
- active site: Q52 (= Q70), I262 (≠ F297), L283 (= L318), G305 (= G340), N335 (≠ H367), L338 (≠ Q370)
- binding flavin-adenine dinucleotide: V178 (= V206), S206 (≠ T234), G207 (= G235), W209 (vs. gap), R307 (≠ V342), H332 (≠ Y364), R334 (≠ G366), N335 (≠ H367), G336 (= G368), I337 (≠ T369)
Sites not aligning to the query:
- active site: 45, 48, 49
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
25% identity, 75% coverage: 68:387/424 of query aligns to 51:357/377 of Q5L2C2
- V180 (= V206) binding
- R309 (≠ V342) binding
- 334:340 (vs. 364:370, 14% identical) binding
- R336 (≠ G366) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
26% identity, 75% coverage: 68:387/424 of query aligns to 50:355/368 of 4yshB
- active site: Q52 (= Q70), I262 (≠ F297), L283 (= L318), G305 (= G340), N335 (≠ H367), L338 (≠ Q370)
- binding flavin-adenine dinucleotide: V178 (= V206), S206 (≠ T234), W209 (vs. gap), R307 (≠ V342), H332 (≠ Y364), R334 (≠ G366), N335 (≠ H367), G336 (= G368), I337 (≠ T369), L338 (≠ Q370)
- binding glycine: G249 (≠ Y286), Y251 (≠ R288), Y251 (≠ R288), A264 (≠ G299), R307 (≠ V342), R334 (≠ G366), R334 (≠ G366)
Sites not aligning to the query:
- active site: 45, 48, 49
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
5fjnA Structure of l-amino acid deaminase from proteus myxofaciens in complex with anthranilate (see paper)
26% identity, 52% coverage: 14:235/424 of query aligns to 17:231/447 of 5fjnA
- active site: S67 (= S64), Y71 (≠ G68), S72 (≠ G69)
- binding flavin-adenine dinucleotide: I34 (= I31), G35 (= G32), G37 (= G34), I38 (≠ F35), Q39 (≠ T36), L57 (≠ V54), E58 (≠ D55), K59 (≠ A56), E65 (≠ G62), Q66 (≠ A63), S67 (= S64), A70 (≠ N67), Y71 (≠ G68), S72 (≠ G69), Q73 (= Q70), V201 (= V206), G230 (≠ T234), G231 (= G235)
Sites not aligning to the query:
- active site: 252
- binding 2-aminobenzoic acid: 252, 289, 411, 412
- binding flavin-adenine dinucleotide: 233, 252, 254, 343, 385, 410, 411, 412, 413, 414, 415
5fjmA Structure of l-amino acid deaminase from proteus myxofaciens (see paper)
26% identity, 52% coverage: 14:235/424 of query aligns to 17:231/447 of 5fjmA
- active site: S67 (= S64), Y71 (≠ G68), S72 (≠ G69)
- binding flavin-adenine dinucleotide: I34 (= I31), G35 (= G32), G37 (= G34), I38 (≠ F35), Q39 (≠ T36), L57 (≠ V54), E58 (≠ D55), K59 (≠ A56), E65 (≠ G62), Q66 (≠ A63), S67 (= S64), A70 (≠ N67), Y71 (≠ G68), S72 (≠ G69), Q73 (= Q70), V201 (= V206), G230 (≠ T234), G231 (= G235)
Sites not aligning to the query:
- active site: 252
- binding flavin-adenine dinucleotide: 233, 252, 254, 343, 385, 410, 411, 412, 413, 414, 415
8p84B X-ray structure of thermoanaerobacterales bacterium monoamine oxidase (see paper)
28% identity, 50% coverage: 27:240/424 of query aligns to 5:268/450 of 8p84B
- binding flavin-adenine dinucleotide: V9 (≠ I31), G10 (= G32), G12 (= G34), A14 (≠ T36), E33 (≠ D55), A34 (= A56), R35 (vs. gap), G40 (= G61), R41 (≠ G62), T42 (≠ A63), G56 (= G69), Q57 (= Q70), W58 (≠ N72), V234 (= V206), V262 (≠ T234)
- binding magnesium ion: E125 (≠ R110), H188 (≠ Q164)
Sites not aligning to the query:
Query Sequence
>H281DRAFT_06337 FitnessBrowser__Burk376:H281DRAFT_06337
MKLESYWLDTAPPFVTACEGPVDGLADVVVIGAGFTGLSAALALGKRGASVTVVDAGRVG
GGASGRNGGQVNTGVAQDFVALAAQLGIERASACYRAFADAVDTVERLIREEQIDCDYLA
SGKLKLASKPHHLAHLEKTADLIRRTVDTDIELIDGDRIRSEVQSDSFHGGLLQRHGGQM
HMGKFTVGLAEAAVRRGAKLYENAAVTSIVKDGGAHRVVTTRGEVRAKQVLIATGPSRHG
PFGWYRRRLAPVGSFIVVTEPLPPELLAKVLPNRRAYTTTRLMHNYFRVTPDSRLLFGGR
ARFTASERPSDAKSGRILQQGLAVMFPMLSSARIDYCWGGLVDISADRLPHAGQHDGIYF
SMGYSGHGTQMSTHMGQVMADVMDGREDRNPWGESEWAAIPGHTGKPWFLPLVGTYYRIK
DIFY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory