Comparing H281DRAFT_06342 FitnessBrowser__Burk376:H281DRAFT_06342 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3fcrA Crystal structure of putative aminotransferase (yp_614685.1) from silicibacter sp. Tm1040 at 1.80 a resolution
43% identity, 94% coverage: 5:447/473 of query aligns to 7:457/458 of 3fcrA
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
41% identity, 93% coverage: 5:446/473 of query aligns to 8:456/460 of 5kr6B
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
40% identity, 94% coverage: 3:446/473 of query aligns to 2:452/455 of 5kr5A
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
38% identity, 92% coverage: 10:446/473 of query aligns to 9:438/443 of 7qx0B
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
40% identity, 94% coverage: 3:446/473 of query aligns to 5:453/458 of 5kr3A
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
40% identity, 94% coverage: 5:449/473 of query aligns to 6:457/459 of 5kquC
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
39% identity, 88% coverage: 31:446/473 of query aligns to 3:417/422 of 7qx3A
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
39% identity, 93% coverage: 5:446/473 of query aligns to 2:445/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
39% identity, 93% coverage: 5:446/473 of query aligns to 2:445/451 of 6g4eA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
39% identity, 93% coverage: 5:446/473 of query aligns to 2:445/453 of 6g4dB
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
38% identity, 95% coverage: 1:449/473 of query aligns to 1:448/450 of 6gwiB
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
39% identity, 94% coverage: 5:447/473 of query aligns to 7:447/448 of 6io1B
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
37% identity, 94% coverage: 4:449/473 of query aligns to 1:441/443 of 6fyqA
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
38% identity, 91% coverage: 25:454/473 of query aligns to 26:453/454 of 7ypmA
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
39% identity, 93% coverage: 10:448/473 of query aligns to 13:458/458 of 3gjuA
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
37% identity, 95% coverage: 4:454/473 of query aligns to 1:453/455 of 7ypnD
7q9xAAA Probable aminotransferase
38% identity, 93% coverage: 8:445/473 of query aligns to 8:444/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
38% identity, 93% coverage: 8:445/473 of query aligns to 8:444/455 of 4a6tC
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
38% identity, 93% coverage: 8:445/473 of query aligns to 7:443/453 of 6s4gA
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
39% identity, 88% coverage: 31:448/473 of query aligns to 2:381/384 of 5ti8B
>H281DRAFT_06342 FitnessBrowser__Burk376:H281DRAFT_06342
MPIQSLIEADRQHLIHPVINYRAHEARGVTVLESASGAFLRDAAGNELLDAFSGLWCVNV
GYGQQSIVEAATAQMKKLPYATSYFHFGSEPAIELAQKLASVAPASLQHVYFTLGGSDAV
DSAIRFITHYFNATGRPSKKHIIALQRGYHGSSSMGAGLTALPAFHRNFDLPLPNQHHLP
SPYAYRSNFADDAALIAASVAALEAKVAELGADNVAAFFCEPIQGSGGVIVPPFGWLKAM
RESCRKLGILFLADEVITGFGRTGPLFACQGESVEPDLMTVAKGLTAGYAPMGAVLMSDE
IYQGIADGDAEAIVGHGHTYSAHPVSAAIGLEVLRLYHEGGLLANGAARAPRFARGLDAL
LEHPLVGDSRHRGLLGALELVSNKDSKAQFDPALKLSERIAAAAYENRLIFRAFGDNILG
FAPALSYTESDFDMMFERLEKTLDDVLAQPDVRAALSGKNAANNRVKSTAAAC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory