Comparing H281DRAFT_06394 FitnessBrowser__Burk376:H281DRAFT_06394 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
48% identity, 99% coverage: 1:230/233 of query aligns to 5:239/240 of 1ji0A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
32% identity, 98% coverage: 2:229/233 of query aligns to 2:235/240 of 6mjpA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
32% identity, 97% coverage: 3:229/233 of query aligns to 3:235/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
32% identity, 97% coverage: 3:229/233 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
32% identity, 97% coverage: 3:229/233 of query aligns to 3:235/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 97% coverage: 3:229/233 of query aligns to 4:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 97% coverage: 3:228/233 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 97% coverage: 3:228/233 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
32% identity, 97% coverage: 3:227/233 of query aligns to 3:233/233 of 6b8bA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 98% coverage: 2:229/233 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 98% coverage: 2:229/233 of query aligns to 4:253/254 of 1g6hA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 91% coverage: 2:212/233 of query aligns to 2:218/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 89% coverage: 5:212/233 of query aligns to 4:218/240 of 4ymuJ
Q8IUA7 ATP-binding cassette sub-family A member 9; EC 7.6.2.- from Homo sapiens (Human) (see 2 papers)
34% identity, 85% coverage: 18:214/233 of query aligns to 500:700/1624 of Q8IUA7
Sites not aligning to the query:
P34358 ABC transporter ced-7; Cell death protein 7 from Caenorhabditis elegans (see 2 papers)
33% identity, 85% coverage: 18:214/233 of query aligns to 563:761/1704 of P34358
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 85% coverage: 14:212/233 of query aligns to 12:210/348 of 3d31A
Sites not aligning to the query:
P55339 ABC-type transporter ATP-binding protein EcsA from Bacillus subtilis (strain 168) (see paper)
28% identity, 96% coverage: 2:225/233 of query aligns to 3:229/247 of P55339
Q8N139 ATP-binding cassette sub-family A member 6; EC 7.6.2.- from Homo sapiens (Human) (see 2 papers)
32% identity, 90% coverage: 6:214/233 of query aligns to 485:697/1617 of Q8N139
Sites not aligning to the query:
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 94% coverage: 1:219/233 of query aligns to 83:325/345 of Q9AT00
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
31% identity, 89% coverage: 2:208/233 of query aligns to 2:217/220 of 8tzjA
>H281DRAFT_06394 FitnessBrowser__Burk376:H281DRAFT_06394
MILDVQQIHGFYGKSHILQGVSLQIAEGETVTLLGRNGAGKSTTLKAIAGVVAPKNGSVT
FNGATISGLQPHKIASRGVCFVPEHRGIFRLLTVEENLRLGARKDSPWQLDDIYRIFPRL
KERRTNGGGQLSGGEQQMLAVGRALMNHPRLLMLDEPVEGLAPVIVEEIVAQLKLIREAG
VAILLVEQNLEVCTQLADRHYIIEQGVIVYSGDNASFAADDSVKDRYLGVGVV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory