Comparing H281DRAFT_06395 FitnessBrowser__Burk376:H281DRAFT_06395 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
36% identity, 96% coverage: 4:248/255 of query aligns to 1:236/240 of 6mjpA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 95% coverage: 5:247/255 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 95% coverage: 5:247/255 of query aligns to 4:253/254 of 1g6hA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
34% identity, 96% coverage: 4:247/255 of query aligns to 1:235/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
34% identity, 96% coverage: 4:247/255 of query aligns to 1:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
34% identity, 96% coverage: 4:247/255 of query aligns to 1:235/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
33% identity, 96% coverage: 4:247/255 of query aligns to 2:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
34% identity, 95% coverage: 4:246/255 of query aligns to 1:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
34% identity, 95% coverage: 4:246/255 of query aligns to 1:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
33% identity, 95% coverage: 4:245/255 of query aligns to 1:233/233 of 6b8bA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
30% identity, 97% coverage: 1:247/255 of query aligns to 2:238/240 of 1ji0A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 94% coverage: 5:243/255 of query aligns to 2:234/241 of 4u00A
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
31% identity, 92% coverage: 3:236/255 of query aligns to 2:224/285 of 4yerA
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
30% identity, 85% coverage: 20:236/255 of query aligns to 3825:4030/5034 of Q5SSE9
Sites not aligning to the query:
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
30% identity, 87% coverage: 15:235/255 of query aligns to 20:239/257 of P0AAH0
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
27% identity, 91% coverage: 5:235/255 of query aligns to 3:225/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
27% identity, 91% coverage: 5:235/255 of query aligns to 3:225/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
27% identity, 91% coverage: 5:235/255 of query aligns to 3:225/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
27% identity, 91% coverage: 5:235/255 of query aligns to 3:225/242 of 2oljA
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
30% identity, 89% coverage: 3:229/255 of query aligns to 2:222/501 of P04983
>H281DRAFT_06395 FitnessBrowser__Burk376:H281DRAFT_06395
MSEAILNASGLVKRYGKFTALSEVNLSIMPRTVHSVIGPNGAGKTTLFHVLTGTLPITAG
TIVFDGHDVTHEPDHKRVRRGVARSFQVTSLFANLSVQENLRLAAQGVDSVRALNAWSPP
RGALAHTETVDDILERLALQRFSKVSAGALSHGQQRRLEVGMALAARPKAIFLDEPTSGM
GIDDLDDMKQLIRGLREDYTVVLIEHNMGIVMDISDTITVMQQGRVLVEGRPDEIRGDER
VRSAYLGNMITGGRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory