Comparing H281DRAFT_06476 FitnessBrowser__Burk376:H281DRAFT_06476 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
69% identity, 96% coverage: 11:263/263 of query aligns to 2:254/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
69% identity, 96% coverage: 11:263/263 of query aligns to 6:258/258 of P02915
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
54% identity, 95% coverage: 12:262/263 of query aligns to 2:240/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
52% identity, 94% coverage: 12:259/263 of query aligns to 4:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
52% identity, 94% coverage: 12:259/263 of query aligns to 4:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
52% identity, 94% coverage: 12:259/263 of query aligns to 4:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
52% identity, 94% coverage: 12:259/263 of query aligns to 4:239/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
52% identity, 95% coverage: 12:262/263 of query aligns to 3:240/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 90% coverage: 25:262/263 of query aligns to 19:245/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 90% coverage: 25:262/263 of query aligns to 20:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 90% coverage: 25:262/263 of query aligns to 20:246/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 90% coverage: 25:262/263 of query aligns to 20:246/344 of 6cvlD
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
35% identity, 96% coverage: 10:261/263 of query aligns to 16:266/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
35% identity, 96% coverage: 10:261/263 of query aligns to 16:266/382 of 7aheC
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
40% identity, 78% coverage: 12:217/263 of query aligns to 4:202/226 of 5xu1B
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
40% identity, 78% coverage: 12:217/263 of query aligns to 4:198/223 of 2pclA
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
39% identity, 87% coverage: 12:239/263 of query aligns to 2:226/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
38% identity, 87% coverage: 12:239/263 of query aligns to 2:226/230 of 1l2tA
7ahdC Opua (e190q) occluded (see paper)
35% identity, 94% coverage: 10:255/263 of query aligns to 16:260/260 of 7ahdC
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
41% identity, 78% coverage: 12:217/263 of query aligns to 5:203/648 of P75831
>H281DRAFT_06476 FitnessBrowser__Burk376:H281DRAFT_06476
LLHTTQTEACKLAVQDIHKRYGDNEVLKGVSLNANKGDVISIIGASGSGKSTFLRCINFL
ERPNAGQIVVDGETVKTKADRAGNLEVADHKQLQRIRTKLAMVFQHFNLWAHMNVIENIV
EAPIHVLGLPRREAEERAREYLEKVGLAPRLEKQYPSHLSGGQQQRVAIARALAMDPDVM
LFDEPTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHVMFLHQGRTEEEG
LPAEVLSSPRSERLKQFLSGSLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory